|
ETH_00000055 | ETH_00000055-t26_1 | 14 | 14 | 1 | | | reverse | protein coding | No | 3696 | ETH_00000055 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675721:47,809..54,724(-) | HG675721:47809..54724(-) | HG675721 | Eimeria tenella strain Houghton | 35 | OG6_102131 | 0 | 1231 | 3696 | 136156 | 6.51 | 3 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00000055ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00000055 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00000245 | ETH_00000245-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 399 | ETH_00000245 | ubiquitin carboxyl-terminal hydrolase isozyme, putative | ubiquitin carboxyl-terminal hydrolase isozyme, putative | | | Not Assigned | HG676337:1,279..1,866(+) | HG676337:1279..1866(+) | HG676337 | Eimeria tenella strain Houghton | 30 | OG6_101218 | 0 | 132 | 399 | 14477 | 3.73 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00000245ORubiquitin carboxyl-terminal hydrolase isozyme, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00000245 OR ubiquitin carboxyl-terminal hydrolase isozyme, putative AND Eimeria tenella strain Houghton |
|
ETH_00000395 | ETH_00000395-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 399 | ETH_00000395 | subtilase family serine protease, putative | subtilase family serine protease, putative | | | Not Assigned | HG675812:582..3,435(+) | HG675812:582..3435(+) | HG675812 | Eimeria tenella strain Houghton | 22 | OG6_490834 | 0 | 133 | 399 | 14608 | 4.06 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00000395ORsubtilase family serine protease, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00000395 OR subtilase family serine protease, putative AND Eimeria tenella strain Houghton |
|
ETH_00000555 | ETH_00000555-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 378 | ETH_00000555 | hypothetical protein | hypothetical protein | | | Not Assigned | HG678164:4,284..4,661(+) | HG678164:4284..4661(+) | HG678164 | Eimeria tenella strain Houghton | 0 | OG6r1_278207 | 0 | 125 | 378 | 13642 | 8.56 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00000555ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00000555 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00000700 | ETH_00000700-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1038 | ETH_00000700 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675760:22,557..23,594(-) | HG675760:22557..23594(-) | HG675760 | Eimeria tenella strain Houghton | 589 | OG6_100000 | 20 | 345 | 1038 | 38816 | 8.56 | 0 | | | | | GO:0003676;GO:0008270 | nucleic acid binding;zinc ion binding | | | | | | | | | | 2.3.2.27 (RING-type E3 ubiquitin transferase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00000700ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00000700 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00000750 | ETH_00000750-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 555 | ETH_00000750 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675760:48,257..48,811(-) | HG675760:48257..48811(-) | HG675760 | Eimeria tenella strain Houghton | 0 | OG6r1_277656 | 0 | 184 | 555 | 21158 | 5.32 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00000750ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00000750 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00000830 | ETH_00000830-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 843 | ETH_00000830 | proteasome component PRE3 precursor, putative | proteasome component PRE3 precursor, putative | | | Not Assigned | HG678261:86,237..87,168(-) | HG678261:86237..87168(-) | HG678261 | Eimeria tenella strain Houghton | 26 | OG6_101390 | 0 | 280 | 843 | 29513 | 6.24 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00000830ORproteasome component PRE3 precursor, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00000830 OR proteasome component PRE3 precursor, putative AND Eimeria tenella strain Houghton |
|
ETH_00000865 | ETH_00000865-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 1812 | ETH_00000865 | ulp1 protease family, C-terminal catalytic domain-containing protein, putative | ulp1 protease family, C-terminal catalytic domain-containing protein, putative | | | Not Assigned | HG678260:1,063..3,731(+) | HG678260:1063..3731(+) | HG678260 | Eimeria tenella strain Houghton | 1 | OG6_116061 | 0 | 603 | 1812 | 60563 | 4.90 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00000865ORulp1 protease family, C-terminal catalytic domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00000865 OR ulp1 protease family, C-terminal catalytic domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00000920 | ETH_00000920-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 1521 | ETH_00000920 | hypothetical protein | hypothetical protein | | | Not Assigned | HG678077:99..2,441(-) | HG678077:99..2441(-) | HG678077 | Eimeria tenella strain Houghton | 28 | OG6_164791 | 0 | 506 | 1521 | 49548 | 6.16 | 0 | HMM: MDAASSASFWTFSASMASSGAHTS, NN: MDAASSASFWTFSASMASSGAHTS | NN Sum: 0, NN D: .23, HMM Prob: .94 | | | | | | | | | | | | | | 3.4.14.5 (Dipeptidyl-peptidase IV) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00000920ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00000920 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00001105 | ETH_00001105-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 132 | ETH_00001105 | hypothetical protein | hypothetical protein | | | Not Assigned | HG673792:115,620..115,751(+) | HG673792:115620..115751(+) | HG673792 | Eimeria tenella strain Houghton | 0 | OG6r1_277927 | 0 | 43 | 132 | 4589 | 3.79 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00001105ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00001105 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00001340 | ETH_00001340-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 738 | ETH_00001340 | proteasome subunit alpha type 7, putative | proteasome subunit alpha type 7, putative | | | Not Assigned | HG675681:55,518..57,709(-) | HG675681:55518..57709(-) | HG675681 | Eimeria tenella strain Houghton | 27 | OG6_101207 | 0 | 245 | 738 | 26993 | 6.93 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00001340ORproteasome subunit alpha type 7, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00001340 OR proteasome subunit alpha type 7, putative AND Eimeria tenella strain Houghton |
|
ETH_00001365 | ETH_00001365-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 396 | ETH_00001365 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675681:65,901..66,296(-) | HG675681:65901..66296(-) | HG675681 | Eimeria tenella strain Houghton | 0 | OG6r1_277628 | 0 | 131 | 396 | 13652 | 4.12 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00001365ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00001365 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00001425 | ETH_00001425-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1860 | ETH_00001425 | At4g25680, related | At4g25680, related | | | Not Assigned | HG675681:148,148..151,416(-) | HG675681:148148..151416(-) | HG675681 | Eimeria tenella strain Houghton | 48 | OG6_101256 | 0 | 619 | 1860 | 66483 | 6.34 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00001425ORAt4g25680, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00001425 OR At4g25680, related AND Eimeria tenella strain Houghton |
|
ETH_00001555 | ETH_00001555-t26_1 | 15 | 15 | 1 | | | forward | protein coding | No | 5601 | ETH_00001555 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | Not Assigned | HG673769:45,550..55,943(+) | HG673769:45550..55943(+) | HG673769 | Eimeria tenella strain Houghton | 33 | OG6_101317 | 0 | 1866 | 5601 | 201937 | 6.00 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00001555ORubiquitin carboxyl-terminal hydrolase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00001555 OR ubiquitin carboxyl-terminal hydrolase, putative AND Eimeria tenella strain Houghton |
|
ETH_00001580 | ETH_00001580-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1356 | ETH_00001580 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG673769:75,692..77,429(-) | HG673769:75692..77429(-) | HG673769 | Eimeria tenella strain Houghton | 22 | OG6_162756 | 1 | 451 | 1356 | 48392 | 5.10 | 0 | HMM: MMGGPLLQATWLILLASAALSH, NN: MMGGPLLQATWLILLASAALSHLGTNAV | NN Sum: 4, NN D: .7, HMM Prob: 1 | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.17.1 (Carboxypeptidase A) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00001580ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00001580 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00001585 | ETH_00001585-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1239 | ETH_00001585 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG673769:78,863..80,808(-) | HG673769:78863..80808(-) | HG673769 | Eimeria tenella strain Houghton | 2 | OG6_225532 | 0 | 412 | 1239 | 45172 | 10.92 | 3 | | | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00001585ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00001585 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00001590 | ETH_00001590-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 297 | ETH_00001590 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG673769:80,830..81,126(-) | HG673769:80830..81126(-) | HG673769 | Eimeria tenella strain Houghton | 3 | OG6_369781 | 0 | 98 | 297 | 10511 | 8.52 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00001590ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00001590 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00001595 | ETH_00001595-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 558 | ETH_00001595 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG673769:81,175..81,799(-) | HG673769:81175..81799(-) | HG673769 | Eimeria tenella strain Houghton | 0 | OG6r1_277374 | 0 | 185 | 558 | 20236 | 9.53 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00001595ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00001595 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00001600 | ETH_00001600-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1095 | ETH_00001600 | hypothetical protein | hypothetical protein | | | Not Assigned | HG673769:82,262..83,620(-) | HG673769:82262..83620(-) | HG673769 | Eimeria tenella strain Houghton | 50 | OG6_103622 | 1 | 364 | 1095 | 39735 | 8.44 | 0 | HMM: MRRIVFAVGAALAVKRAEAD, NN: MRRIVFAVGAALAVKRAEAD | NN Sum: 4, NN D: .65, HMM Prob: 1 | | | | | | | | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00001600ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00001600 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00001725 | ETH_00001725-t26_1 | 9 | 9 | 1 | | | reverse | protein coding | No | 1071 | ETH_00001725 | Aspartyl proteinase (Eimepsin) | Aspartyl proteinase (Eimepsin) | | | Not Assigned | HG675705:67,514..69,604(-) | HG675705:67514..69604(-) | HG675705 | Eimeria tenella strain Houghton | 50 | OG6_100536 | 1 | 356 | 1071 | 39417 | 6.32 | 0 | HMM: MRSLLVVAGIAGCSSLAATDAR, NN: MRSLLVVAGIAGCSSLAATD | NN Sum: 3, NN D: .52, HMM Prob: 1 | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00001725ORAspartyl proteinase (Eimepsin)ANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00001725 OR Aspartyl proteinase (Eimepsin) AND Eimeria tenella strain Houghton |
|
ETH_00001730 | ETH_00001730-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 3000 | ETH_00001730 | insulysin, putative | insulysin, putative | | | Not Assigned | HG675705:72,432..75,933(-) | HG675705:72432..75933(-) | HG675705 | Eimeria tenella strain Houghton | 85 | OG6_100422 | 3 | 999 | 3000 | 110717 | 5.29 | 0 | HMM: MRNAASVGLCVGLSAIGALAN, NN: MRNAASVGLCVGLSAIGALAN | NN Sum: 4, NN D: .61, HMM Prob: .99 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00001730ORinsulysin, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00001730 OR insulysin, putative AND Eimeria tenella strain Houghton |
|
ETH_00001930 | ETH_00001930-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 846 | ETH_00001930 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG677973:1,318..3,246(-) | HG677973:1318..3246(-) | HG677973 | Eimeria tenella strain Houghton | 61 | OG6_100915 | 2 | 281 | 846 | 30474 | 8.01 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00001930ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00001930 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00002175 | ETH_00002175-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 468 | ETH_00002175 | Proteasome subunit beta type , related | Proteasome subunit beta type , related | | | Not Assigned | HG678363:293..760(-) | HG678363:293..760(-) | HG678363 | Eimeria tenella strain Houghton | 22 | OG6_102061 | 1 | 155 | 468 | 14900 | 4.10 | 2 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00002175ORProteasome subunit beta type , relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00002175 OR Proteasome subunit beta type , related AND Eimeria tenella strain Houghton |
|
ETH_00002580 | ETH_00002580-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 702 | ETH_00002580 | ubiquitin carboxyl-terminal hydrolase isozyme L5, putative | ubiquitin carboxyl-terminal hydrolase isozyme L5, putative | | | Not Assigned | HG673764:86,949..89,678(+) | HG673764:86949..89678(+) | HG673764 | Eimeria tenella strain Houghton | 34 | OG6_102753 | 1 | 233 | 702 | 25564 | 4.94 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00002580ORubiquitin carboxyl-terminal hydrolase isozyme L5, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00002580 OR ubiquitin carboxyl-terminal hydrolase isozyme L5, putative AND Eimeria tenella strain Houghton |
|
ETH_00002825 | ETH_00002825-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 1563 | ETH_00002825 | amidohydrolase domain-containing protein, putative | amidohydrolase domain-containing protein, putative | | | Not Assigned | HG675649:98,518..101,892(+) | HG675649:98518..101892(+) | HG675649 | Eimeria tenella strain Houghton | 30 | OG6_101553 | 0 | 520 | 1563 | 55752 | 6.51 | 0 | HMM: MLHSRRLSRCICILIFLATTAKRAETA, NN: MLHSRRLSRCICILIFLATTAKRAETA | NN Sum: 3, NN D: .63, HMM Prob: .97 | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00002825ORamidohydrolase domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00002825 OR amidohydrolase domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00002850 | ETH_00002850-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 1122 | ETH_00002850 | Hydrolase of the alpha/beta superfamily, related | Hydrolase of the alpha/beta superfamily, related | | | Not Assigned | HG675649:143,904..146,917(+) | HG675649:143904..146917(+) | HG675649 | Eimeria tenella strain Houghton | 43 | OG6_101827 | 2 | 373 | 1122 | 39089 | 5.02 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00002850ORHydrolase of the alpha/beta superfamily, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00002850 OR Hydrolase of the alpha/beta superfamily, related AND Eimeria tenella strain Houghton |
|
ETH_00002855 | ETH_00002855-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 990 | ETH_00002855 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675649:149,009..151,645(-) | HG675649:149009..151645(-) | HG675649 | Eimeria tenella strain Houghton | 82 | OG6_102272 | 2 | 329 | 990 | 37421 | 9.39 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00002855ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00002855 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00002875 | ETH_00002875-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 1029 | ETH_00002875 | phospholipase/carboxylesterase domain containing protein, putative | phospholipase/carboxylesterase domain containing protein, putative | | | Not Assigned | HG675649:170,652..173,509(+) | HG675649:170652..173509(+) | HG675649 | Eimeria tenella strain Houghton | 43 | OG6_101827 | 2 | 342 | 1029 | 38258 | 7.62 | 1 | HMM: MSWWSLAAILTRAAWVGGFLLSVVVGL, NN: MSWWSLAAILTRAAWVGGFLLSVVVGL | NN Sum: 2, NN D: .61, HMM Prob: .4 | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00002875ORphospholipase/carboxylesterase domain containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00002875 OR phospholipase/carboxylesterase domain containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00002910 | ETH_00002910-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 1488 | ETH_00002910 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675649:197,781..201,349(+) | HG675649:197781..201349(+) | HG675649 | Eimeria tenella strain Houghton | 41 | OG6_101235 | 0 | 495 | 1488 | 53895 | 8.63 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00002910ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00002910 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00002965 | ETH_00002965-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 1140 | ETH_00002965 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675649:250,665..253,019(+) | HG675649:250665..253019(+) | HG675649 | Eimeria tenella strain Houghton | 27 | OG6_116896 | 0 | 379 | 1140 | 40768 | 9.14 | 0 | HMM: MGFKFVAAALAALLALLLALRLDPGVTTA, NN: MGFKFVAAALAALLALLLALRLDPGVTTA | NN Sum: 4, NN D: .86, HMM Prob: 1 | | | | | | | | | | | | | | 2.3.-.- (Acyltransferases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00002965ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00002965 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00003260 | ETH_00003260-t26_1 | 19 | 19 | 1 | | | forward | protein coding | No | 3582 | ETH_00003260 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | Not Assigned | HG673758:99,567..111,062(+) | HG673758:99567..111062(+) | HG673758 | Eimeria tenella strain Houghton | 39 | OG6_101021 | 0 | 1193 | 3582 | 130054 | 6.34 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00003260ORubiquitin carboxyl-terminal hydrolase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00003260 OR ubiquitin carboxyl-terminal hydrolase, putative AND Eimeria tenella strain Houghton |
|
ETH_00003350 | ETH_00003350-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 2211 | ETH_00003350 | Presequence protease, related | Presequence protease, related | | | Not Assigned | HG677178:509..4,474(-) | HG677178:509..4474(-) | HG677178 | Eimeria tenella strain Houghton | 45 | OG6_101809 | 4 | 736 | 2211 | 77966 | 7.00 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00003350ORPresequence protease, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00003350 OR Presequence protease, related AND Eimeria tenella strain Houghton |
|
ETH_00003360 | ETH_00003360-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 507 | ETH_00003360 | Chromosome III, complete sequence, related | Chromosome III, complete sequence, related | | | Not Assigned | HG676199:585..1,864(-) | HG676199:585..1864(-) | HG676199 | Eimeria tenella strain Houghton | 36 | OG6_113142 | 1 | 168 | 507 | 19360 | 4.65 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00003360ORChromosome III, complete sequence, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00003360 OR Chromosome III, complete sequence, related AND Eimeria tenella strain Houghton |
|
ETH_00003570 | ETH_00003570-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1539 | ETH_00003570 | cysteine proteinase, putative | cysteine proteinase, putative | | | Not Assigned | HG674553:37,510..39,048(-) | HG674553:37510..39048(-) | HG674553 | Eimeria tenella strain Houghton | 29 | OG6_101151 | 0 | 512 | 1539 | 56940 | 5.89 | 0 | HMM: MRIGKLWATLAISSPLIFSCAM, NN: MRIGKLWATLAISSPLIFSCAM | NN Sum: 3, NN D: .62, HMM Prob: .98 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.1 (Cathepsin B) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00003570ORcysteine proteinase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00003570 OR cysteine proteinase, putative AND Eimeria tenella strain Houghton |
|
ETH_00003860 | ETH_00003860-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 657 | ETH_00003860 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675710:12,376..14,604(+) | HG675710:12376..14604(+) | HG675710 | Eimeria tenella strain Houghton | 0 | OG6_100561 | 0 | 218 | 657 | 24234 | 7.08 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00003860ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00003860 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00003895 | ETH_00003895-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1080 | ETH_00003895 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675710:31,156..32,294(-) | HG675710:31156..32294(-) | HG675710 | Eimeria tenella strain Houghton | 7 | OG6_106819 | 2 | 359 | 1080 | 39953 | 7.76 | 0 | | | | | GO:0003676;GO:0008270 | nucleic acid binding;zinc ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00003895ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00003895 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00004075 | ETH_00004075-t26_1 | 10 | 10 | 1 | | | reverse | protein coding | No | 4377 | ETH_00004075 | calpain family cysteine protease domain-containing protein, putative | calpain family cysteine protease domain-containing protein, putative | | | Not Assigned | HG675689:45,775..52,950(-) | HG675689:45775..52950(-) | HG675689 | Eimeria tenella strain Houghton | 27 | OG6_103851 | 0 | 1458 | 4377 | 155372 | 8.19 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00004075ORcalpain family cysteine protease domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00004075 OR calpain family cysteine protease domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00004260 | ETH_00004260-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1062 | ETH_00004260 | proliferation-associated protein 2g4, putative | proliferation-associated protein 2g4, putative | | | Not Assigned | HG675689:225,150..227,470(-) | HG675689:225150..227470(-) | HG675689 | Eimeria tenella strain Houghton | 27 | OG6_101895 | 1 | 353 | 1062 | 36414 | 7.03 | 0 | HMM: MLEVCGVRTPERKGFAAAAAAAAAAGAPHAA, NN: MLEVCGVRTPERKGFAAAAAAAAAAGAPHAA | NN Sum: 0, NN D: .1, HMM Prob: .92 | | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00004260ORproliferation-associated protein 2g4, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00004260 OR proliferation-associated protein 2g4, putative AND Eimeria tenella strain Houghton |
|
ETH_00004480 | ETH_00004480-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 426 | ETH_00004480 | Protein F23B2.12, partially confirmed by transcript evidence, related, related | Protein F23B2.12, partially confirmed by transcript evidence, related, related | | | Not Assigned | HG675395:772..1,539(+) | HG675395:772..1539(+) | HG675395 | Eimeria tenella strain Houghton | 34 | OG6_100644 | 0 | 141 | 426 | 14202 | 8.26 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.2 (Lysosomal Pro-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00004480ORProtein F23B2.12, partially confirmed by transcript evidence, related, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00004480 OR Protein F23B2.12, partially confirmed by transcript evidence, related, related AND Eimeria tenella strain Houghton |
|
ETH_00004650 | ETH_00004650-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1776 | ETH_00004650 | GPI-anchor transamidase, putative | GPI-anchor transamidase, putative | | | Not Assigned | HG673746:112,178..113,953(-) | HG673746:112178..113953(-) | HG673746 | Eimeria tenella strain Houghton | 25 | OG6_101767 | 0 | 591 | 1776 | 63745 | 7.50 | 1 | HMM: MPQQQQQLLLLLLLLLPFLLSLLAL, NN: MPQQQQQLLLLLLLLLPFLLSLLAL | NN Sum: 4, NN D: .83, HMM Prob: 1 | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00004650ORGPI-anchor transamidase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00004650 OR GPI-anchor transamidase, putative AND Eimeria tenella strain Houghton |
|
ETH_00004705 | ETH_00004705-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 1164 | ETH_00004705 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG673746:169,873..172,878(-) | HG673746:169873..172878(-) | HG673746 | Eimeria tenella strain Houghton | 0 | OG6r1_277349 | 0 | 387 | 1164 | 42619 | 7.46 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00004705ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00004705 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00004860 | ETH_00004860-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 1617 | ETH_00004860 | apical membrane antigen, putative | apical membrane antigen, putative | | | Not Assigned | HG673746:403,601..406,234(+) | HG673746:403601..406234(+) | HG673746 | Eimeria tenella strain Houghton | 51 | OG6_130922 | 1 | 538 | 1617 | 59046 | 5.26 | 1 | HMM: MEALREGFGLRRLCCISAVAAFCLFGAKPSQAA, NN: MEALREGFGLRRLCCISAVAAF | NN Sum: 4, NN D: .48, HMM Prob: .8 | GO:0016020 | membrane | | | GO:0009405 | pathogenesis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00004860ORapical membrane antigen, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00004860 OR apical membrane antigen, putative AND Eimeria tenella strain Houghton |
|
ETH_00004990 | ETH_00004990-t26_1 | 13 | 13 | 1 | | | forward | protein coding | No | 1950 | ETH_00004990 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | Not Assigned | HG673746:534,308..538,423(+) | HG673746:534308..538423(+) | HG673746 | Eimeria tenella strain Houghton | 31 | OG6_153953 | 0 | 649 | 1950 | 73191 | 6.61 | 0 | HMM: MFVRTSSSSCWRKTLDELFLSSPLLRGRWNSHLVRILRGFFLLCLFESAAAE, NN: MFVRTSSSSCWRKTLDELFLSSPLLRGRWNSHLVRILRGFFLLCLFESAAAE | NN Sum: 3, NN D: .37, HMM Prob: .99 | | | GO:0003677 | DNA binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00004990ORubiquitin carboxyl-terminal hydrolase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00004990 OR ubiquitin carboxyl-terminal hydrolase, putative AND Eimeria tenella strain Houghton |
|
ETH_00005000 | ETH_00005000-t26_1 | 11 | 11 | 1 | | | reverse | protein coding | No | 4026 | ETH_00005000 | Chromosome III, complete sequence, related | Chromosome III, complete sequence, related | | | Not Assigned | HG673746:545,500..551,662(-) | HG673746:545500..551662(-) | HG673746 | Eimeria tenella strain Houghton | 3 | OG6_108095 | 0 | 1341 | 4026 | 143254 | 6.46 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00005000ORChromosome III, complete sequence, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00005000 OR Chromosome III, complete sequence, related AND Eimeria tenella strain Houghton |
|
ETH_00005180 | ETH_00005180-t26_1 | 14 | 14 | 1 | | | forward | protein coding | No | 4122 | ETH_00005180 | hypothetical protein | hypothetical protein | | | Not Assigned | HG673746:771,013..777,780(+) | HG673746:771013..777780(+) | HG673746 | Eimeria tenella strain Houghton | 31 | OG6_112296 | 0 | 1373 | 4122 | 151789 | 7.35 | 0 | HMM: MRGPPIKPTRPLIVGFQLLQYLLSE, NN: MRGPPIKPTRPLIVGFQLLQYLLSE | NN Sum: 3, NN D: .51, HMM Prob: .86 | | | | | | | | | | | | | | 1.14.13.- (With NADH or NADPH as one donor, and incorporation of one atom of oxygen.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00005180ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00005180 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00005260 | ETH_00005260-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 882 | ETH_00005260 | der1-like family domain-containing protein, conserved, putative | der1-like family domain-containing protein, conserved, putative | | | Not Assigned | HG673746:884,678..887,898(-) | HG673746:884678..887898(-) | HG673746 | Eimeria tenella strain Houghton | 23 | OG6_113960 | 0 | 293 | 882 | 31340 | 9.26 | 4 | HMM: MEAGMGGLRGLERGPEVWWRSLPGVTRAAAAASLLLALLASTSLL, NN: MEAGMGGLRGLERGPEVWWRSLPGVTRAAAAASLLLALLASTSLL | NN Sum: 2, NN D: .34, HMM Prob: .96 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00005260ORder1-like family domain-containing protein, conserved, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00005260 OR der1-like family domain-containing protein, conserved, putative AND Eimeria tenella strain Houghton |
|
ETH_00005465 | ETH_00005465-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1617 | ETH_00005465 | hydrolase, alpha/beta fold family domain-containing protein, putative | hydrolase, alpha/beta fold family domain-containing protein, putative | | | Not Assigned | HG673746:1,110,715..1,112,331(-) | HG673746:1110715..1112331(-) | HG673746 | Eimeria tenella strain Houghton | 28 | OG6_101420 | 1 | 538 | 1617 | 57932 | 8.76 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00005465ORhydrolase, alpha/beta fold family domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00005465 OR hydrolase, alpha/beta fold family domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00005495 | ETH_00005495-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1068 | ETH_00005495 | Reverse transcriptase, related | Reverse transcriptase, related | | | Not Assigned | HG673746:1,184,465..1,185,613(-) | HG673746:1184465..1185613(-) | HG673746 | Eimeria tenella strain Houghton | 3 | OG6r1_116203 | 0 | 355 | 1068 | 38808 | 6.13 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00005495ORReverse transcriptase, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00005495 OR Reverse transcriptase, related AND Eimeria tenella strain Houghton |
|
ETH_00005505 | ETH_00005505-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 951 | ETH_00005505 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG673746:1,188,773..1,190,017(+) | HG673746:1188773..1190017(+) | HG673746 | Eimeria tenella strain Houghton | 589 | OG6_100000 | 20 | 316 | 951 | 34504 | 5.25 | 0 | | | | | | | | | | | | | | | | 2.3.2.27 (RING-type E3 ubiquitin transferase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00005505ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00005505 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00005615 | ETH_00005615-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1188 | ETH_00005615 | WD domain, G-beta repeat-containing protein, putative | WD domain, G-beta repeat-containing protein, putative | | | Not Assigned | HG675415:6,834..8,480(+) | HG675415:6834..8480(+) | HG675415 | Eimeria tenella strain Houghton | 26 | OG6_102663 | 0 | 395 | 1188 | 43442 | 9.26 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00005615ORWD domain, G-beta repeat-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00005615 OR WD domain, G-beta repeat-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00005680 | ETH_00005680-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 432 | ETH_00005680 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675415:106,508..106,939(-) | HG675415:106508..106939(-) | HG675415 | Eimeria tenella strain Houghton | 0 | OG6r1_277660 | 0 | 143 | 432 | 16006 | 9.58 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00005680ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00005680 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00005915 | ETH_00005915-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 1839 | ETH_00005915 | 1-O-acylceramide synthase, putative | 1-O-acylceramide synthase, putative | | | Not Assigned | HG673800:45,436..48,778(+) | HG673800:45436..48778(+) | HG673800 | Eimeria tenella strain Houghton | 29 | OG6_101376 | 0 | 612 | 1839 | 67540 | 5.11 | 1 | HMM: MKSLGSGVSVRAVWVVQWYRLLGLLFCSYAFLGVLVQHGVSCT, NN: MKSLGSGVSVRAVWVVQWYRLLGLLFCSYAF | NN Sum: 2, NN D: .6, HMM Prob: .86 | | | GO:0008374 | O-acyltransferase activity | GO:0006629 | lipid metabolic process | | | | | | | | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00005915OR1-O-acylceramide synthase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00005915 OR 1-O-acylceramide synthase, putative AND Eimeria tenella strain Houghton |
|
ETH_00005950 | ETH_00005950-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 855 | ETH_00005950 | Subtilisin-like protein, related | Subtilisin-like protein, related | | | Not Assigned | HG676192:1,466..2,509(-) | HG676192:1466..2509(-) | HG676192 | Eimeria tenella strain Houghton | 25 | OG6_105356 | 0 | 284 | 855 | 30482 | 9.92 | 1 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00005950ORSubtilisin-like protein, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00005950 OR Subtilisin-like protein, related AND Eimeria tenella strain Houghton |
|
ETH_00006275 | ETH_00006275-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1038 | ETH_00006275 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675342:314,588..315,886(-) | HG675342:314588..315886(-) | HG675342 | Eimeria tenella strain Houghton | 815 | OG6_100282 | 76 | 345 | 1038 | 39166 | 4.47 | 0 | HMM: MPALKRFLFFSGFCFSLLASQPTCGA, NN: MPALKRFLFFSGFCFSLLAS | NN Sum: 4, NN D: .69, HMM Prob: 1 | | | | | | | | | | | | | | 1.3.1.74 (2-alkenal reductase (NAD(P)(+))) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00006275ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00006275 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00006500 | ETH_00006500-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 228 | ETH_00006500 | hypothetical protein | hypothetical protein | | | Not Assigned | HG678352:3,102..3,941(-) | HG678352:3102..3941(-) | HG678352 | Eimeria tenella strain Houghton | 27 | OG6_101895 | 1 | 75 | 228 | 8586 | 10.22 | 0 | | | | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00006500ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00006500 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00006590 | ETH_00006590-t26_1 | 11 | 11 | 1 | | | forward | protein coding | No | 1272 | ETH_00006590 | 26S protease regulatory subunit 6a, putative | 26S protease regulatory subunit 6a, putative | | | Not Assigned | HG675732:62,260..66,542(+) | HG675732:62260..66542(+) | HG675732 | Eimeria tenella strain Houghton | 42 | OG6_101915 | 0 | 423 | 1272 | 47153 | 4.91 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00006590OR26S protease regulatory subunit 6a, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00006590 OR 26S protease regulatory subunit 6a, putative AND Eimeria tenella strain Houghton |
|
ETH_00006785 | ETH_00006785-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 1056 | ETH_00006785 | proteasome A-type and B-type domain-containing protein, putative | proteasome A-type and B-type domain-containing protein, putative | | | Not Assigned | HG675727:31,863..34,296(+) | HG675727:31863..34296(+) | HG675727 | Eimeria tenella strain Houghton | 26 | OG6_101718 | 0 | 351 | 1056 | 37810 | 5.73 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00006785ORproteasome A-type and B-type domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00006785 OR proteasome A-type and B-type domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00006825 | ETH_00006825-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 3303 | ETH_00006825 | Whole genome shotgun assembly, reference scaffold old set, scaffold scaffold_12, related | Whole genome shotgun assembly, reference scaffold old set, scaffold scaffold_12, related | | | Not Assigned | HG675727:86,387..90,583(+) | HG675727:86387..90583(+) | HG675727 | Eimeria tenella strain Houghton | 57 | OG6_121085 | 0 | 1100 | 3303 | 120805 | 6.47 | 0 | HMM: MAPGIWSLTLCLAVLGRHMLSTALQD, NN: MAPGIWSLTLCLAVLGRHMLSTAL | NN Sum: 3, NN D: .61, HMM Prob: 1 | | | GO:0005509;GO:0004252 | calcium ion binding;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00006825ORWhole genome shotgun assembly, reference scaffold old set, scaffold scaffold_12, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00006825 OR Whole genome shotgun assembly, reference scaffold old set, scaffold scaffold_12, related AND Eimeria tenella strain Houghton |
|
ETH_00006870 | ETH_00006870-t26_1 | 12 | 12 | 1 | | | forward | protein coding | No | 1587 | ETH_00006870 | prolidase, putative | prolidase, putative | | | Not Assigned | HG675727:122,132..125,871(+) | HG675727:122132..125871(+) | HG675727 | Eimeria tenella strain Houghton | 28 | OG6_102295 | 0 | 528 | 1587 | 58651 | 6.04 | 0 | | | | | GO:0004177;GO:0030145 | aminopeptidase activity;manganese ion binding | | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00006870ORprolidase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00006870 OR prolidase, putative AND Eimeria tenella strain Houghton |
|
ETH_00006900 | ETH_00006900-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1500 | ETH_00006900 | ulp1 protease family, C-terminal catalytic domain-containing protein, putative | ulp1 protease family, C-terminal catalytic domain-containing protein, putative | | | Not Assigned | HG675727:144,793..146,605(-) | HG675727:144793..146605(-) | HG675727 | Eimeria tenella strain Houghton | 13 | OG6_102905 | 0 | 499 | 1500 | 56015 | 9.42 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00006900ORulp1 protease family, C-terminal catalytic domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00006900 OR ulp1 protease family, C-terminal catalytic domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00007025 | ETH_00007025-t26_1 | 9 | 9 | 1 | | | reverse | protein coding | No | 1338 | ETH_00007025 | Eukaryotic translation initiation factor 3 subunit B, related | Eukaryotic translation initiation factor 3 subunit B, related | | | Not Assigned | HG675684:4,389..7,894(-) | HG675684:4389..7894(-) | HG675684 | Eimeria tenella strain Houghton | 34 | OG6_101924 | 1 | 445 | 1338 | 52582 | 5.95 | 0 | | | | | | | | | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00007025OREukaryotic translation initiation factor 3 subunit B, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00007025 OR Eukaryotic translation initiation factor 3 subunit B, related AND Eimeria tenella strain Houghton |
|
ETH_00007290 | ETH_00007290-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 600 | ETH_00007290 | signal peptidase subunit, putative | signal peptidase subunit, putative | | | Not Assigned | HG675628:251,951..252,782(-) | HG675628:251951..252782(-) | HG675628 | Eimeria tenella strain Houghton | 28 | OG6_102447 | 0 | 199 | 600 | 22396 | 8.38 | 1 | HMM: MESYLNRANAVFCALMVSLSVLAI, NN: MESYLNRANAVFCALMVSLSVLAI | NN Sum: 4, NN D: .62, HMM Prob: .72 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00007290ORsignal peptidase subunit, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00007290 OR signal peptidase subunit, putative AND Eimeria tenella strain Houghton |
|
ETH_00007310 | ETH_00007310-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1830 | ETH_00007310 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | Not Assigned | HG675628:273,673..276,974(-) | HG675628:273673..276974(-) | HG675628 | Eimeria tenella strain Houghton | 35 | OG6_101892 | 0 | 609 | 1830 | 65154 | 5.82 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00007310ORubiquitin carboxyl-terminal hydrolase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00007310 OR ubiquitin carboxyl-terminal hydrolase, putative AND Eimeria tenella strain Houghton |
|
ETH_00007345 | ETH_00007345-t26_1 | 9 | 9 | 1 | | | reverse | protein coding | No | 4020 | ETH_00007345 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675611:77,022..82,493(-) | HG675611:77022..82493(-) | HG675611 | Eimeria tenella strain Houghton | 66 | OG6_110270 | 0 | 1339 | 4020 | 149205 | 7.62 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00007345ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00007345 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00007405 | ETH_00007405-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 4623 | ETH_00007405 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675611:134,368..139,832(+) | HG675611:134368..139832(+) | HG675611 | Eimeria tenella strain Houghton | 3 | OG6_393426 | 0 | 1540 | 4623 | 160719 | 7.41 | 0 | HMM: MSLQRIARCTHTSCLAFAAFHSRAA, NN: MSLQRIARCTHTSCLAFAAFHSRAA | NN Sum: 0, NN D: .28, HMM Prob: .98 | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00007405ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00007405 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00007420 | ETH_00007420-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 3261 | ETH_00007420 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675611:160,752..165,517(+) | HG675611:160752..165517(+) | HG675611 | Eimeria tenella strain Houghton | 23 | OG6_158722 | 0 | 1086 | 3261 | 115493 | 6.13 | 0 | HMM: MSAIKIQPALLTLTCCLLCLGAAAE, NN: MSAIKIQPALLTLTCCLLCLGAAAE | NN Sum: 4, NN D: .85, HMM Prob: 1 | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00007420ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00007420 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00007755 | ETH_00007755-t26_1 | 21 | 21 | 1 | | | reverse | protein coding | No | 4038 | ETH_00007755 | transcription elongation factor FACT 140 kDa, putative | transcription elongation factor FACT 140 kDa, putative | | | Not Assigned | HG674029:86,092..97,281(-) | HG674029:86092..97281(-) | HG674029 | Eimeria tenella strain Houghton | 31 | OG6_102309 | 0 | 1345 | 4038 | 148187 | 5.37 | 0 | | | | | | | | | | | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00007755ORtranscription elongation factor FACT 140 kDa, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00007755 OR transcription elongation factor FACT 140 kDa, putative AND Eimeria tenella strain Houghton |
|
ETH_00007865 | ETH_00007865-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 609 | ETH_00007865 | ubiquitin-conjugating enzyme, putative | ubiquitin-conjugating enzyme, putative | | | Not Assigned | HG674029:217,566..220,315(+) | HG674029:217566..220315(+) | HG674029 | Eimeria tenella strain Houghton | 24 | OG6_103192 | 0 | 202 | 609 | 22842 | 4.74 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00007865ORubiquitin-conjugating enzyme, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00007865 OR ubiquitin-conjugating enzyme, putative AND Eimeria tenella strain Houghton |
|
ETH_00007910 | ETH_00007910-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 945 | ETH_00007910 | hypothetical protein | hypothetical protein | | | Not Assigned | HG674029:274,551..275,719(+) | HG674029:274551..275719(+) | HG674029 | Eimeria tenella strain Houghton | 0 | OG6r1_278100 | 0 | 314 | 945 | 35091 | 8.34 | 0 | | | | | GO:0003676;GO:0008270 | nucleic acid binding;zinc ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00007910ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00007910 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00007970 | ETH_00007970-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 267 | ETH_00007970 | hypothetical protein | hypothetical protein | | | Not Assigned | HG674029:326,320..326,586(+) | HG674029:326320..326586(+) | HG674029 | Eimeria tenella strain Houghton | 0 | OG6r1_278041 | 0 | 88 | 267 | 9363 | 4.16 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00007970ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00007970 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00008070 | ETH_00008070-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 672 | ETH_00008070 | hypothetical protein | hypothetical protein | | | Not Assigned | HG676376:287..1,984(+) | HG676376:287..1984(+) | HG676376 | Eimeria tenella strain Houghton | 36 | OG6_100411 | 3 | 223 | 672 | 24722 | 6.52 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00008070ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00008070 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00008525 | ETH_00008525-t26_1 | 9 | 9 | 1 | | | reverse | protein coding | No | 1767 | ETH_00008525 | eukaryotic aspartyl protease, putative | eukaryotic aspartyl protease, putative | | | Not Assigned | HG675758:109,119..112,860(-) | HG675758:109119..112860(-) | HG675758 | Eimeria tenella strain Houghton | 24 | OG6_119797 | 0 | 588 | 1767 | 64378 | 5.70 | 0 | HMM: MKWRYWGPGLALLCALSEGLAA, NN: MKWRYWGPGLALLCALSEGLAA | NN Sum: 4, NN D: .66, HMM Prob: 1 | | | | | | | | | | | | | | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00008525OReukaryotic aspartyl protease, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00008525 OR eukaryotic aspartyl protease, putative AND Eimeria tenella strain Houghton |
|
ETH_00008560 | ETH_00008560-t26_1 | 23 | 23 | 1 | | | forward | protein coding | No | 5427 | ETH_00008560 | intracellular protease, putative | intracellular protease, putative | | | Not Assigned | HG675758:159,709..174,890(+) | HG675758:159709..174890(+) | HG675758 | Eimeria tenella strain Houghton | 41 | OG6_103377 | 0 | 1808 | 5427 | 191113 | 6.06 | 0 | HMM: MSNPLQRSEAAGTAGPAAAAAPAAAAAAAAAGPTAATAAPTSPATAAAPAAAAAAPTAAAAA, NN: MSNPLQRSEAAGTAGPAAAAAPAAAAAAAAAGPTAATAA | NN Sum: 0, NN D: .1, HMM Prob: 1 | | | GO:0003723;GO:0005488;GO:0005515 | RNA binding;binding;protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00008560ORintracellular protease, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00008560 OR intracellular protease, putative AND Eimeria tenella strain Houghton |
|
ETH_00008785 | ETH_00008785-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 789 | ETH_00008785 | proteasome subunit alpha type 1, putative | proteasome subunit alpha type 1, putative | | | Not Assigned | HG675758:358,135..360,498(+) | HG675758:358135..360498(+) | HG675758 | Eimeria tenella strain Houghton | 31 | OG6_102143 | 0 | 262 | 789 | 28596 | 7.27 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00008785ORproteasome subunit alpha type 1, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00008785 OR proteasome subunit alpha type 1, putative AND Eimeria tenella strain Houghton |
|
ETH_00008925 | ETH_00008925-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 2427 | ETH_00008925 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675758:585,490..589,103(+) | HG675758:585490..589103(+) | HG675758 | Eimeria tenella strain Houghton | 3 | OG6_208753 | 0 | 808 | 2427 | 88624 | 9.91 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00008925ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00008925 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00009130 | ETH_00009130-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 600 | ETH_00009130 | sterol-regulatory element binding protein site 2 protease, putative | sterol-regulatory element binding protein site 2 protease, putative | | | Not Assigned | HG675750:150,640..153,266(-) | HG675750:150640..153266(-) | HG675750 | Eimeria tenella strain Houghton | 24 | OG6_107106 | 0 | 199 | 600 | 20856 | 6.47 | 4 | | | | | | | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00009130ORsterol-regulatory element binding protein site 2 protease, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00009130 OR sterol-regulatory element binding protein site 2 protease, putative AND Eimeria tenella strain Houghton |
|
ETH_00009260 | ETH_00009260-t26_1 | 18 | 18 | 1 | | | forward | protein coding | No | 7365 | ETH_00009260 | acetyl-CoA carboxylase, putative | acetyl-CoA carboxylase, putative | | | Not Assigned | HG675744:139,098..151,257(+) | HG675744:139098..151257(+) | HG675744 | Eimeria tenella strain Houghton | 85 | OG6_101052 | 0 | 2454 | 7365 | 266526 | 6.79 | 1 | HMM: MYTKRARRQGNLGLLRFILSFTLLPSLSPLLLLLPALLAPTAAWAF, NN: MYTKRARRQGNLGLLRFILSFTLLPSLSPLLLLLPALLAPTAAWAF | NN Sum: 3, NN D: .62, HMM Prob: 1 | | | GO:0005524;GO:0003989;GO:0016874;GO:0046872 | ATP binding;acetyl-CoA carboxylase activity;ligase activity;metal ion binding | GO:0006633 | fatty acid biosynthetic process | | | | | | | | 6.4.1.2 (Acetyl-CoA carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00009260ORacetyl-CoA carboxylase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00009260 OR acetyl-CoA carboxylase, putative AND Eimeria tenella strain Houghton |
|
ETH_00009270 | ETH_00009270-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 3369 | ETH_00009270 | subtilase family serine protease, putative | subtilase family serine protease, putative | | | Not Assigned | HG675744:161,411..167,557(+) | HG675744:161411..167557(+) | HG675744 | Eimeria tenella strain Houghton | 29 | OG6_113449 | 1 | 1122 | 3369 | 114299 | 7.74 | 0 | HMM: MKNKEAAASLKWRSRGSCVVVAAATEAA, NN: MKNKEAAASLKWRSRGSCVVVAAATEAA | NN Sum: 0, NN D: .16, HMM Prob: .93 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00009270ORsubtilase family serine protease, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00009270 OR subtilase family serine protease, putative AND Eimeria tenella strain Houghton |
|
ETH_00009675 | ETH_00009675-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 676 | ETH_00009675 | proteasome subunit beta type 5, putative | proteasome subunit beta type 5, putative | | | Not Assigned | HG673821:438,716..441,970(+) | HG673821:438716..441970(+) | HG673821 | Eimeria tenella strain Houghton | 27 | OG6_100897 | 0 | 225 | 676 | 24240 | 7.28 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00009675ORproteasome subunit beta type 5, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00009675 OR proteasome subunit beta type 5, putative AND Eimeria tenella strain Houghton |
|
ETH_00009790 | ETH_00009790-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 435 | ETH_00009790 | protease | protease | | | Not Assigned | HG677997:117..5,072(+) | HG677997:117..5072(+) | HG677997 | Eimeria tenella strain Houghton | 20 | OG6_116777 | 1 | 145 | 435 | 15409 | 4.36 | 0 | HMM: MLRVWALGALESSKSAAV, NN: MLRVWALGALESSKSAAV | NN Sum: 3, NN D: .51, HMM Prob: .65 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00009790ORproteaseANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00009790 OR protease AND Eimeria tenella strain Houghton |
|
ETH_00009820 | ETH_00009820-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 1887 | ETH_00009820 | Rhomboid-like protease 4 | Rhomboid-like protease 4 | | | Not Assigned | HG675668:17,896..24,658(+) | HG675668:17896..24658(+) | HG675668 | Eimeria tenella strain Houghton | 29 | OG6_126349 | 0 | 628 | 1887 | 66812 | 9.03 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00009820ORRhomboid-like protease 4ANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00009820 OR Rhomboid-like protease 4 AND Eimeria tenella strain Houghton |
|
ETH_00010035 | ETH_00010035-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 729 | ETH_00010035 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675668:269,706..270,434(+) | HG675668:269706..270434(+) | HG675668 | Eimeria tenella strain Houghton | 12 | OG6r1_102050 | 0 | 242 | 729 | 27556 | 7.06 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00010035ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00010035 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00010520 | ETH_00010520-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 600 | ETH_00010520 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675655:96,653..97,252(-) | HG675655:96653..97252(-) | HG675655 | Eimeria tenella strain Houghton | 0 | OG6r1_278051 | 0 | 199 | 600 | 22100 | 6.63 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00010520ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00010520 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00010605 | ETH_00010605-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 2850 | ETH_00010605 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675655:200,879..204,767(+) | HG675655:200879..204767(+) | HG675655 | Eimeria tenella strain Houghton | 56 | OG6_110414 | 2 | 949 | 2850 | 100803 | 8.99 | 0 | | | | | | | | | | | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00010605ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00010605 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00010630 | ETH_00010630-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2088 | ETH_00010630 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675655:237,501..239,640(-) | HG675655:237501..239640(-) | HG675655 | Eimeria tenella strain Houghton | 25 | OG6_490279 | 1 | 695 | 2088 | 72092 | 7.20 | 0 | HMM: MGNAAASSVAASTASSSGSCSSC, NN: MGNAAASSVAASTASSSGSCS | NN Sum: 0, NN D: .08, HMM Prob: .94 | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00010630ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00010630 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00010800 | ETH_00010800-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 684 | ETH_00010800 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675688:97,319..98,002(+) | HG675688:97319..98002(+) | HG675688 | Eimeria tenella strain Houghton | 1 | OG6_131106 | 2 | 227 | 684 | 25681 | 7.23 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00010800ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00010800 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00010805 | ETH_00010805-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 348 | ETH_00010805 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675688:98,383..98,730(+) | HG675688:98383..98730(+) | HG675688 | Eimeria tenella strain Houghton | 5 | OG6r1_109219 | 0 | 115 | 348 | 12241 | 4.22 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00010805ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00010805 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00010825 | ETH_00010825-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 726 | ETH_00010825 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675688:109,171..109,896(-) | HG675688:109171..109896(-) | HG675688 | Eimeria tenella strain Houghton | 1 | OG6_131106 | 2 | 241 | 726 | 27459 | 8.42 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00010825ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00010825 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00010985 | ETH_00010985-t26_1 | 16 | 16 | 1 | | | forward | protein coding | No | 3618 | ETH_00010985 | AFG3 ATPase family protein, putative | AFG3 ATPase family protein, putative | | | Not Assigned | HG675688:279,526..286,502(+) | HG675688:279526..286502(+) | HG675688 | Eimeria tenella strain Houghton | 42 | OG6_100384 | 0 | 1205 | 3618 | 131674 | 8.56 | 0 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00010985ORAFG3 ATPase family protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00010985 OR AFG3 ATPase family protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00011050 | ETH_00011050-t26_1 | 16 | 16 | 1 | | | forward | protein coding | No | 3369 | ETH_00011050 | subtilisin-like protease TgSUB2, putative | subtilisin-like protease TgSUB2, putative | | | Not Assigned | HG675688:335,100..341,769(+) | HG675688:335100..341769(+) | HG675688 | Eimeria tenella strain Houghton | 72 | OG6_100121 | 1 | 1122 | 3369 | 120246 | 4.46 | 1 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00011050ORsubtilisin-like protease TgSUB2, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00011050 OR subtilisin-like protease TgSUB2, putative AND Eimeria tenella strain Houghton |
|
ETH_00011175 | ETH_00011175-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 753 | ETH_00011175 | proteasome subunit alpha type 4, subunit, putative | proteasome subunit alpha type 4, subunit, putative | | | Not Assigned | HG675688:486,408..487,800(-) | HG675688:486408..487800(-) | HG675688 | Eimeria tenella strain Houghton | 28 | OG6_101968 | 0 | 250 | 753 | 27717 | 6.80 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00011175ORproteasome subunit alpha type 4, subunit, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00011175 OR proteasome subunit alpha type 4, subunit, putative AND Eimeria tenella strain Houghton |
|
ETH_00011325 | ETH_00011325-t26_1 | 12 | 12 | 1 | | | reverse | protein coding | No | 1617 | ETH_00011325 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675688:664,997..669,837(-) | HG675688:664997..669837(-) | HG675688 | Eimeria tenella strain Houghton | 32 | OG6_104880 | 0 | 538 | 1617 | 59489 | 6.74 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00011325ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00011325 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00011340 | ETH_00011340-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 885 | ETH_00011340 | subtilase family serine protease, putative | subtilase family serine protease, putative | | | Not Assigned | HG675688:680,091..681,868(+) | HG675688:680091..681868(+) | HG675688 | Eimeria tenella strain Houghton | 33 | OG6_206249 | 1 | 294 | 885 | 31709 | 4.87 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00011340ORsubtilase family serine protease, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00011340 OR subtilase family serine protease, putative AND Eimeria tenella strain Houghton |
|
ETH_00011410 | ETH_00011410-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 786 | ETH_00011410 | proteasome subunit alpha type 5, putative | proteasome subunit alpha type 5, putative | | | Not Assigned | HG678025:1,116..5,355(+) | HG678025:1116..5355(+) | HG678025 | Eimeria tenella strain Houghton | 25 | OG6_101621 | 0 | 261 | 786 | 28156 | 4.71 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00011410ORproteasome subunit alpha type 5, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00011410 OR proteasome subunit alpha type 5, putative AND Eimeria tenella strain Houghton |
|
ETH_00011545 | ETH_00011545-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 3312 | ETH_00011545 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675579:6,916..13,122(-) | HG675579:6916..13122(-) | HG675579 | Eimeria tenella strain Houghton | 25 | OG6_102601 | 0 | 1103 | 3312 | 117210 | 5.25 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00011545ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00011545 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00011625 | ETH_00011625-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1788 | ETH_00011625 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675579:88,687..90,474(+) | HG675579:88687..90474(+) | HG675579 | Eimeria tenella strain Houghton | 6 | OG6_176429 | 0 | 595 | 1788 | 64514 | 9.36 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00011625ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00011625 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00011650 | ETH_00011650-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 375 | ETH_00011650 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675579:128,233..128,607(-) | HG675579:128233..128607(-) | HG675579 | Eimeria tenella strain Houghton | 0 | OG6r1_277334 | 0 | 124 | 375 | 13711 | 8.56 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00011650ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00011650 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00011835 | ETH_00011835-t26_1 | 10 | 10 | 1 | | | reverse | protein coding | No | 1557 | ETH_00011835 | mitochondrial-processing peptidase beta subunit, putative | mitochondrial-processing peptidase beta subunit, putative | | | Not Assigned | HG675579:293,831..297,332(-) | HG675579:293831..297332(-) | HG675579 | Eimeria tenella strain Houghton | 36 | OG6_100777 | 0 | 518 | 1557 | 57495 | 7.05 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00011835ORmitochondrial-processing peptidase beta subunit, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00011835 OR mitochondrial-processing peptidase beta subunit, putative AND Eimeria tenella strain Houghton |
|
ETH_00011840 | ETH_00011840-t26_1 | 16 | 16 | 1 | | | forward | protein coding | No | 6264 | ETH_00011840 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675579:301,132..311,222(+) | HG675579:301132..311222(+) | HG675579 | Eimeria tenella strain Houghton | 26 | OG6_105308 | 0 | 2087 | 6264 | 218061 | 7.60 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00011840ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00011840 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00012015 | ETH_00012015-t26_1 | 9 | 9 | 1 | | 1 | forward | protein coding | No | 2047 | ETH_00012015 | zinc metalloprotease 2, putative | zinc metalloprotease 2, putative | | | Not Assigned | HG675480:5..6,393(+) | HG675480:6..6393(+) | HG675480 | Eimeria tenella strain Houghton | 45 | OG6_101809 | 4 | 681 | 2046 | 72890 | 5.10 | 0 | HMM: SSERLALQALSYLLLGTPTSPL, NN: SSERLALQALSYLLLGTPTS | NN Sum: 1, NN D: .43, HMM Prob: .9 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00012015ORzinc metalloprotease 2, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00012015 OR zinc metalloprotease 2, putative AND Eimeria tenella strain Houghton |
|
ETH_00012075 | ETH_00012075-t26_1 | 12 | 12 | 1 | | | reverse | protein coding | No | 1668 | ETH_00012075 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | Not Assigned | HG673779:27,789..33,958(-) | HG673779:27789..33958(-) | HG673779 | Eimeria tenella strain Houghton | 31 | OG6_102786 | 0 | 555 | 1668 | 61671 | 6.38 | 0 | HMM: MSRAEATAAPAAAPAAAAAAAAEAA, NN: MSRAEATAAPAAAPAAAAAAAAEAA | NN Sum: 0, NN D: .13, HMM Prob: 1 | | | GO:0036459;GO:0008270 | thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00012075ORubiquitin carboxyl-terminal hydrolase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00012075 OR ubiquitin carboxyl-terminal hydrolase, putative AND Eimeria tenella strain Houghton |
|
ETH_00012215 | ETH_00012215-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 2277 | ETH_00012215 | hypothetical protein | hypothetical protein | | | Not Assigned | HG674968:58,609..63,357(-) | HG674968:58609..63357(-) | HG674968 | Eimeria tenella strain Houghton | 111 | OG6_105727 | 2 | 758 | 2277 | 80493 | 7.71 | 0 | | | | | | | | | | | | | | | | 3.4.21.108 (HtrA2 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00012215ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00012215 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00012380 | ETH_00012380-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1599 | ETH_00012380 | cytosol aminopeptidase, putative | cytosol aminopeptidase, putative | | | Not Assigned | HG674968:259,273..263,675(-) | HG674968:259273..263675(-) | HG674968 | Eimeria tenella strain Houghton | 27 | OG6_100682 | 0 | 532 | 1599 | 56305 | 6.51 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00012380ORcytosol aminopeptidase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00012380 OR cytosol aminopeptidase, putative AND Eimeria tenella strain Houghton |
|
ETH_00012405 | ETH_00012405-t26_1 | 13 | 13 | 1 | | | forward | protein coding | No | 1971 | ETH_00012405 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG674968:287,731..291,480(+) | HG674968:287731..291480(+) | HG674968 | Eimeria tenella strain Houghton | 1 | OG6r1_142829 | 0 | 656 | 1971 | 71459 | 4.61 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00012405ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00012405 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00012520 | ETH_00012520-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 579 | ETH_00012520 | 26S proteasome non-ATPase subunit, putative | 26S proteasome non-ATPase subunit, putative | | | Not Assigned | HG673773:37,028..38,365(+) | HG673773:37028..38365(+) | HG673773 | Eimeria tenella strain Houghton | 26 | OG6_101835 | 0 | 192 | 579 | 21762 | 9.68 | 0 | | | | | | | | | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00012520OR26S proteasome non-ATPase subunit, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00012520 OR 26S proteasome non-ATPase subunit, putative AND Eimeria tenella strain Houghton |
|
ETH_00012555 | ETH_00012555-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 2274 | ETH_00012555 | X-Pro dipeptidyl-peptidase domain-containing protein, putative | X-Pro dipeptidyl-peptidase domain-containing protein, putative | | | Not Assigned | HG673773:64,319..69,912(+) | HG673773:64319..69912(+) | HG673773 | Eimeria tenella strain Houghton | 29 | OG6_124529 | 0 | 757 | 2274 | 80271 | 8.46 | 0 | | | | | GO:0008239;GO:0016787 | dipeptidyl-peptidase activity;hydrolase activity | | | | | | | | | | 3.1.1.- (Carboxylic ester hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00012555ORX-Pro dipeptidyl-peptidase domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00012555 OR X-Pro dipeptidyl-peptidase domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00012925 | ETH_00012925-t26_1 | 10 | 10 | 1 | | | reverse | protein coding | No | 1209 | ETH_00012925 | 26S proteasome regulatory ATPase subunit, putative | 26S proteasome regulatory ATPase subunit, putative | | | Not Assigned | HG673747:70,074..73,863(-) | HG673747:70074..73863(-) | HG673747 | Eimeria tenella strain Houghton | 39 | OG6_101751 | 0 | 402 | 1209 | 45242 | 8.66 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00012925OR26S proteasome regulatory ATPase subunit, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00012925 OR 26S proteasome regulatory ATPase subunit, putative AND Eimeria tenella strain Houghton |
|
ETH_00013105 | ETH_00013105-t26_1 | 12 | 12 | 1 | | | forward | protein coding | No | 3033 | ETH_00013105 | aminopeptidase N, putative | aminopeptidase N, putative | | | Not Assigned | HG673747:270,511..276,522(+) | HG673747:270511..276522(+) | HG673747 | Eimeria tenella strain Houghton | 105 | OG6_106799 | 7 | 1010 | 3033 | 112965 | 5.52 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00013105ORaminopeptidase N, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00013105 OR aminopeptidase N, putative AND Eimeria tenella strain Houghton |
|
ETH_00013695 | ETH_00013695-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 993 | ETH_00013695 | eukaryotic translation initiation factor 3 subunit 5, putative | eukaryotic translation initiation factor 3 subunit 5, putative | | | Not Assigned | HG675754:147,561..148,836(-) | HG675754:147561..148836(-) | HG675754 | Eimeria tenella strain Houghton | 29 | OG6_103242 | 0 | 330 | 993 | 36697 | 4.82 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00013695OReukaryotic translation initiation factor 3 subunit 5, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00013695 OR eukaryotic translation initiation factor 3 subunit 5, putative AND Eimeria tenella strain Houghton |
|
ETH_00013740 | ETH_00013740-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 2364 | ETH_00013740 | hypothetical protein | hypothetical protein | | | Not Assigned | HG678156:466..5,050(+) | HG678156:466..5050(+) | HG678156 | Eimeria tenella strain Houghton | 36 | OG6_174421 | 2 | 787 | 2364 | 80704 | 4.87 | 0 | HMM: MFLFAAGVTLRLVAAHGWRPRLAIFWAAPACSSSSSSSSSSCSCSSSRAA, NN: MFLFAAGVTLRLVAAH | NN Sum: 3, NN D: .59, HMM Prob: 1 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00013740ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00013740 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00014220 | ETH_00014220-t26_1 | 17 | 17 | 1 | | | forward | protein coding | No | 2934 | ETH_00014220 | acylamino-acid-releasing enzyme, putative | acylamino-acid-releasing enzyme, putative | | | Not Assigned | HG675722:76,124..82,661(+) | HG675722:76124..82661(+) | HG675722 | Eimeria tenella strain Houghton | 33 | OG6_102438 | 0 | 977 | 2934 | 107104 | 8.36 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00014220ORacylamino-acid-releasing enzyme, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00014220 OR acylamino-acid-releasing enzyme, putative AND Eimeria tenella strain Houghton |
|
ETH_00014275 | ETH_00014275-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 906 | ETH_00014275 | Cytosolic non-specific dipeptidase, related | Cytosolic non-specific dipeptidase, related | | | Not Assigned | HG675722:149,791..151,550(-) | HG675722:149791..151550(-) | HG675722 | Eimeria tenella strain Houghton | 39 | OG6_100503 | 1 | 301 | 906 | 32371 | 8.12 | 0 | | | | | | | | | | | | | | | | 3.4.13.20 (Beta-Ala-His dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00014275ORCytosolic non-specific dipeptidase, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00014275 OR Cytosolic non-specific dipeptidase, related AND Eimeria tenella strain Houghton |
|
ETH_00014590 | ETH_00014590-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 168 | ETH_00014590 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG677158:6,831..7,800(+) | HG677158:6831..7800(+) | HG677158 | Eimeria tenella strain Houghton | 31 | OG6_119794 | 1 | 56 | 168 | 6267 | 3.76 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00014590ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00014590 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00014750 | ETH_00014750-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 639 | ETH_00014750 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675595:134,728..135,537(+) | HG675595:134728..135537(+) | HG675595 | Eimeria tenella strain Houghton | 27 | OG6_101672 | 0 | 212 | 639 | 24797 | 8.21 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00014750ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00014750 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00015060 | ETH_00015060-t26_1 | 10 | 10 | 1 | | 1 | forward | protein coding | No | 1759 | ETH_00015060 | hypothetical protein | hypothetical protein | | | Not Assigned | HG676489:301..4,811(+) | HG676489:302..4811(+) | HG676489 | Eimeria tenella strain Houghton | 119 | OG6_100223 | 4 | 585 | 1758 | 64937 | 8.55 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00015060ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00015060 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00015225 | ETH_00015225-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 313 | ETH_00015225 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG676035:1,533..2,755(+) | HG676035:1533..2755(+) | HG676035 | Eimeria tenella strain Houghton | 27 | OG6_102054 | 1 | 104 | 313 | 11228 | 8.29 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00015225ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00015225 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00015245 | ETH_00015245-t26_1 | 12 | 12 | 1 | | | forward | protein coding | No | 1716 | ETH_00015245 | trypsin, putative | trypsin, putative | | | Not Assigned | HG675259:13,990..18,808(+) | HG675259:13990..18808(+) | HG675259 | Eimeria tenella strain Houghton | 111 | OG6_105727 | 2 | 571 | 1716 | 62364 | 6.97 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.21.108 (HtrA2 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00015245ORtrypsin, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00015245 OR trypsin, putative AND Eimeria tenella strain Houghton |
|
ETH_00015590 | ETH_00015590-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 3756 | ETH_00015590 | lysophospholipase, putative | lysophospholipase, putative | | | Not Assigned | HG673817:22,288..26,531(-) | HG673817:22288..26531(-) | HG673817 | Eimeria tenella strain Houghton | 61 | OG6_100231 | 2 | 1251 | 3756 | 131051 | 4.65 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00015590ORlysophospholipase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00015590 OR lysophospholipase, putative AND Eimeria tenella strain Houghton |
|
ETH_00015595 | ETH_00015595-t26_1 | 12 | 12 | 1 | | | reverse | protein coding | No | 3678 | ETH_00015595 | hypothetical protein | hypothetical protein | | | Not Assigned | HG673817:27,774..35,550(-) | HG673817:27774..35550(-) | HG673817 | Eimeria tenella strain Houghton | 105 | OG6_106799 | 7 | 1225 | 3678 | 133235 | 8.37 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00015595ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00015595 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00015775 | ETH_00015775-t26_1 | 11 | 11 | 1 | | | reverse | protein coding | No | 1335 | ETH_00015775 | 26S proteasome subunit 4, putative | 26S proteasome subunit 4, putative | | | Not Assigned | HG674344:96,517..101,463(-) | HG674344:96517..101463(-) | HG674344 | Eimeria tenella strain Houghton | 32 | OG6_101477 | 0 | 444 | 1335 | 49283 | 5.97 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00015775OR26S proteasome subunit 4, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00015775 OR 26S proteasome subunit 4, putative AND Eimeria tenella strain Houghton |
|
ETH_00015865 | ETH_00015865-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 1449 | ETH_00015865 | acyl-CoA dehydrogenase, putative | acyl-CoA dehydrogenase, putative | | | Not Assigned | HG674344:184,961..189,720(+) | HG674344:184961..189720(+) | HG674344 | Eimeria tenella strain Houghton | 29 | OG6_101810 | 0 | 482 | 1449 | 51786 | 7.26 | 0 | | | | | GO:0016627 | oxidoreductase activity, acting on the CH-CH group of donors | GO:0055114 | oxidation-reduction process | | | | | | | | 1.3.8.6 (Glutaryl-CoA dehydrogenase (ETF)) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00015865ORacyl-CoA dehydrogenase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00015865 OR acyl-CoA dehydrogenase, putative AND Eimeria tenella strain Houghton |
|
ETH_00016620 | ETH_00016620-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 2085 | ETH_00016620 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG673781:41,933..46,018(-) | HG673781:41933..46018(-) | HG673781 | Eimeria tenella strain Houghton | 29 | OG6_124535 | 0 | 694 | 2085 | 73965 | 5.07 | 1 | HMM: MLFLAACCCCCCFLIAGGPARAA, NN: MLFLAACCCCCCFLIAGGPARAAAA | NN Sum: 2, NN D: .48, HMM Prob: 1 | | | | | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00016620ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00016620 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00016670 | ETH_00016670-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 1170 | ETH_00016670 | proteasome subunit alpha type 6, putative | proteasome subunit alpha type 6, putative | | | Not Assigned | HG673781:82,118..84,759(-) | HG673781:82118..84759(-) | HG673781 | Eimeria tenella strain Houghton | 23 | OG6_102240 | 0 | 389 | 1170 | 40886 | 9.38 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00016670ORproteasome subunit alpha type 6, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00016670 OR proteasome subunit alpha type 6, putative AND Eimeria tenella strain Houghton |
|
ETH_00016760 | ETH_00016760-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 375 | ETH_00016760 | microtubial-binding protein, putative | microtubial-binding protein, putative | | | Not Assigned | HG673799:30,185..31,226(+) | HG673799:30185..31226(+) | HG673799 | Eimeria tenella strain Houghton | 24 | OG6_100707 | 0 | 124 | 375 | 14129 | 7.62 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00016760ORmicrotubial-binding protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00016760 OR microtubial-binding protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00016860 | ETH_00016860-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 690 | ETH_00016860 | 26S proteasome regulatory subunit, putative | 26S proteasome regulatory subunit, putative | | | Not Assigned | HG675844:459..3,441(+) | HG675844:459..3441(+) | HG675844 | Eimeria tenella strain Houghton | 27 | OG6_102054 | 1 | 229 | 690 | 25978 | 7.61 | 0 | | | | | | | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00016860OR26S proteasome regulatory subunit, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00016860 OR 26S proteasome regulatory subunit, putative AND Eimeria tenella strain Houghton |
|
ETH_00016890 | ETH_00016890-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 4506 | ETH_00016890 | subtilase family serine protease, putative | subtilase family serine protease, putative | | | Not Assigned | HG674448:31,195..38,524(-) | HG674448:31195..38524(-) | HG674448 | Eimeria tenella strain Houghton | 25 | OG6_156705 | 0 | 1501 | 4506 | 160621 | 5.00 | 0 | HMM: MRSFLSLFSFLPLPIGNSKRRRLIAAAAAAAAAASCCVLAAAPAHLQGA, NN: MRSFLSLFSFLPLPIGNSKRRRLIAAAAAAAAAA | NN Sum: 2, NN D: .3, HMM Prob: .97 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00016890ORsubtilase family serine protease, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00016890 OR subtilase family serine protease, putative AND Eimeria tenella strain Houghton |
|
ETH_00016920 | ETH_00016920-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 204 | ETH_00016920 | hypothetical protein | hypothetical protein | | | Not Assigned | HG674448:101,557..101,760(+) | HG674448:101557..101760(+) | HG674448 | Eimeria tenella strain Houghton | 0 | OG6r1_278353 | 0 | 67 | 204 | 7614 | 8.09 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00016920ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00016920 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00017225 | ETH_00017225-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1080 | ETH_00017225 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG678390:203..1,528(+) | HG678390:203..1528(+) | HG678390 | Eimeria tenella strain Houghton | 25 | OG6_490279 | 1 | 359 | 1080 | 38773 | 7.23 | 0 | HMM: MFLIGLSLGGWVALRAVQLAAAE, NN: MFLIGLSLGGWVALRAVQLAAAE | NN Sum: 4, NN D: .63, HMM Prob: 1 | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00017225ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00017225 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00017305 | ETH_00017305-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 1425 | ETH_00017305 | peptidase family M48 domain-containing protein, putative | peptidase family M48 domain-containing protein, putative | | | Not Assigned | HG675742:60,676..63,230(+) | HG675742:60676..63230(+) | HG675742 | Eimeria tenella strain Houghton | 37 | OG6_101632 | 0 | 474 | 1425 | 54307 | 7.85 | 5 | HMM: MRLLSGSWFSDVPWLHVYVGFSLTIEAF, NN: MRLLSGSWFSDVPWLHVYVGFSLTIEAF | NN Sum: 4, NN D: .42, HMM Prob: .17 | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.84 (Ste24 endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00017305ORpeptidase family M48 domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00017305 OR peptidase family M48 domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00017485 | ETH_00017485-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 465 | ETH_00017485 | hypothetical protein | hypothetical protein | | | Not Assigned | HG677920:616..1,345(-) | HG677920:616..1345(-) | HG677920 | Eimeria tenella strain Houghton | 105 | OG6_106799 | 7 | 154 | 465 | 16504 | 10.61 | 0 | | | | | | | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00017485ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00017485 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00017840 | ETH_00017840-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1809 | ETH_00017840 | Esterase/lipase domain-containing protein, related | Esterase/lipase domain-containing protein, related | | | Not Assigned | HG673920:139,171..140,979(-) | HG673920:139171..140979(-) | HG673920 | Eimeria tenella strain Houghton | 61 | OG6_100915 | 2 | 602 | 1809 | 66047 | 8.61 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00017840OREsterase/lipase domain-containing protein, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00017840 OR Esterase/lipase domain-containing protein, related AND Eimeria tenella strain Houghton |
|
ETH_00017885 | ETH_00017885-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 1425 | ETH_00017885 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG673920:205,010..207,435(+) | HG673920:205010..207435(+) | HG673920 | Eimeria tenella strain Houghton | 61 | OG6_100231 | 2 | 474 | 1425 | 50102 | 8.59 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00017885ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00017885 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00018250 | ETH_00018250-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 561 | ETH_00018250 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675751:106,002..106,562(+) | HG675751:106002..106562(+) | HG675751 | Eimeria tenella strain Houghton | 1 | OG6_131106 | 2 | 186 | 561 | 21031 | 10.36 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00018250ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00018250 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00018255 | ETH_00018255-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 672 | ETH_00018255 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675751:107,153..107,824(-) | HG675751:107153..107824(-) | HG675751 | Eimeria tenella strain Houghton | 7 | OG6_106819 | 2 | 223 | 672 | 24955 | 10.44 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00018255ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00018255 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00018400 | ETH_00018400-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 4929 | ETH_00018400 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675749:167,956..174,263(+) | HG675749:167956..174263(+) | HG675749 | Eimeria tenella strain Houghton | 0 | OG6_513055 | 0 | 1643 | 4929 | 171171 | 4.99 | 0 | HMM: MARRKHGKGGPGGQLSGAPEEAAAAAAGAAAAADTAAHAA, NN: MARRKHGK | NN Sum: 0, NN D: .1, HMM Prob: .89 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00018400ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00018400 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00018940 | ETH_00018940-t26_1 | 29 | 29 | 1 | | | reverse | protein coding | No | 6810 | ETH_00018940 | C2 domain-containing protein, putative | C2 domain-containing protein, putative | | | Not Assigned | HG675479:90,289..101,920(-) | HG675479:90289..101920(-) | HG675479 | Eimeria tenella strain Houghton | 60 | OG6_126374 | 1 | 2269 | 6810 | 253040 | 6.67 | 0 | | | | | | | | | | | | | | | | 1.3.-.- (Acting on the CH-CH group of donors.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00018940ORC2 domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00018940 OR C2 domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00019080 | ETH_00019080-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1014 | ETH_00019080 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675479:225,730..226,743(-) | HG675479:225730..226743(-) | HG675479 | Eimeria tenella strain Houghton | 2 | OG6_118477 | 2 | 337 | 1014 | 37738 | 10.19 | 0 | | | | | GO:0003676;GO:0008270 | nucleic acid binding;zinc ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00019080ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00019080 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00019755 | ETH_00019755-t26_1 | 10 | 10 | 1 | | | reverse | protein coding | No | 2055 | ETH_00019755 | cathepsin C, putative | cathepsin C, putative | | | Not Assigned | HG675163:683,086..688,807(-) | HG675163:683086..688807(-) | HG675163 | Eimeria tenella strain Houghton | 50 | OG6_103622 | 1 | 684 | 2055 | 73177 | 5.66 | 0 | HMM: MRRTEPAGGGPRGRQGPLLPRLLLPLLLLLCCSSSLLLPVAAD, NN: MRRTEPAGGGPRGRQGPLLPRLLLPLLLLLCCSSSLLLPVAAD | NN Sum: 3, NN D: .51, HMM Prob: .99 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00019755ORcathepsin C, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00019755 OR cathepsin C, putative AND Eimeria tenella strain Houghton |
|
ETH_00019930 | ETH_00019930-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 378 | ETH_00019930 | microsomal signal peptidase subunit SPCS1 domain-containing protein, putative | microsomal signal peptidase subunit SPCS1 domain-containing protein, putative | | | Not Assigned | HG675163:831,094..831,471(+) | HG675163:831094..831471(+) | HG675163 | Eimeria tenella strain Houghton | 20 | OG6_103297 | 0 | 125 | 378 | 13989 | 8.84 | 2 | HMM: MLASAREVLLSLREGVVDFTAQQVLQRLVTMLFALGTCFGF, NN: MLASAREVLLSLREGVVDFTAQQVLQRLVTMLFALGTCFGF | NN Sum: 3, NN D: .44, HMM Prob: .12 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00019930ORmicrosomal signal peptidase subunit SPCS1 domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00019930 OR microsomal signal peptidase subunit SPCS1 domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00020020 | ETH_00020020-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 888 | ETH_00020020 | rhomboid family domain-containing protein, putative | rhomboid family domain-containing protein, putative | | | Not Assigned | HG675163:931,198..933,490(+) | HG675163:931198..933490(+) | HG675163 | Eimeria tenella strain Houghton | 52 | OG6_100562 | 1 | 295 | 888 | 32517 | 9.23 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00020020ORrhomboid family domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00020020 OR rhomboid family domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00020065 | ETH_00020065-t26_1 | 17 | 17 | 1 | | | forward | protein coding | No | 3228 | ETH_00020065 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675163:1,008,622..1,016,912(+) | HG675163:1008622..1016912(+) | HG675163 | Eimeria tenella strain Houghton | 119 | OG6_100223 | 4 | 1075 | 3228 | 118052 | 6.24 | 1 | HMM: MSAAKGRLMGRPPLLLLPTLLLLVLFQGAVGLAQ, NN: MSAAKGRLMGRPPLLLLPTLLLLVLFQGAVGL | NN Sum: 4, NN D: .79, HMM Prob: 1 | GO:0005737 | cytoplasm | GO:0005524 | ATP binding | GO:0019538;GO:0042026;GO:0009408 | protein metabolic process;protein refolding;response to heat | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00020065ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00020065 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00020095 | ETH_00020095-t26_1 | 12 | 12 | 1 | | | forward | protein coding | No | 3300 | ETH_00020095 | 26S protease regulatory subunit 8, putative | 26S protease regulatory subunit 8, putative | | | Not Assigned | HG675163:1,029,848..1,039,698(+) | HG675163:1029848..1039698(+) | HG675163 | Eimeria tenella strain Houghton | 37 | OG6_101513 | 0 | 1099 | 3300 | 117507 | 5.61 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00020095OR26S protease regulatory subunit 8, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00020095 OR 26S protease regulatory subunit 8, putative AND Eimeria tenella strain Houghton |
|
ETH_00020215 | ETH_00020215-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 951 | ETH_00020215 | hypothetical protein | hypothetical protein | | | Not Assigned | HG678175:653..1,603(-) | HG678175:653..1603(-) | HG678175 | Eimeria tenella strain Houghton | 3 | OG6_107221 | 1 | 316 | 951 | 36200 | 10.56 | 0 | | | | | GO:0003676;GO:0008270 | nucleic acid binding;zinc ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00020215ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00020215 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00020530 | ETH_00020530-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1368 | ETH_00020530 | glycoprotease family domain-containing protein, putative | glycoprotease family domain-containing protein, putative | | | Not Assigned | HG675716:103,949..105,530(+) | HG675716:103949..105530(+) | HG675716 | Eimeria tenella strain Houghton | 44 | OG6_100288 | 0 | 455 | 1368 | 49058 | 7.69 | 0 | | | | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00020530ORglycoprotease family domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00020530 OR glycoprotease family domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00020635 | ETH_00020635-t26_1 | 14 | 14 | 1 | | | reverse | protein coding | No | 7641 | ETH_00020635 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | Not Assigned | HG675716:196,027..206,721(-) | HG675716:196027..206721(-) | HG675716 | Eimeria tenella strain Houghton | 33 | OG6_104835 | 0 | 2546 | 7641 | 274852 | 6.57 | 0 | HMM: MKTSPQFSVAPAAAASPAVAI, NN: MKTSPQFSVAPAAAASPAVAI | NN Sum: 1, NN D: .19, HMM Prob: .93 | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00020635ORubiquitin carboxyl-terminal hydrolase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00020635 OR ubiquitin carboxyl-terminal hydrolase, putative AND Eimeria tenella strain Houghton |
|
ETH_00020890 | ETH_00020890-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 336 | ETH_00020890 | hypothetical protein | hypothetical protein | | | Not Assigned | HG677084:120..3,121(-) | HG677084:120..3121(-) | HG677084 | Eimeria tenella strain Houghton | 28 | OG6_124490 | 1 | 111 | 336 | 11846 | 5.47 | 0 | | | | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00020890ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00020890 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00020895 | ETH_00020895-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 903 | ETH_00020895 | methionine aminopeptidase, putative | methionine aminopeptidase, putative | | | Not Assigned | HG677084:3,333..5,678(-) | HG677084:3333..5678(-) | HG677084 | Eimeria tenella strain Houghton | 28 | OG6_124490 | 1 | 300 | 903 | 31110 | 8.82 | 0 | | | | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00020895ORmethionine aminopeptidase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00020895 OR methionine aminopeptidase, putative AND Eimeria tenella strain Houghton |
|
ETH_00021060 | ETH_00021060-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 297 | ETH_00021060 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675067:168,634..168,930(-) | HG675067:168634..168930(-) | HG675067 | Eimeria tenella strain Houghton | 0 | OG6r1_277629 | 0 | 98 | 297 | 10439 | 6.21 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00021060ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00021060 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00021100 | ETH_00021100-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2553 | ETH_00021100 | OTU-like cysteine protease domain-containing protein, putative | OTU-like cysteine protease domain-containing protein, putative | | | Not Assigned | HG675067:209,265..212,048(-) | HG675067:209265..212048(-) | HG675067 | Eimeria tenella strain Houghton | 25 | OG6_104209 | 0 | 850 | 2553 | 88039 | 9.73 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00021100OROTU-like cysteine protease domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00021100 OR OTU-like cysteine protease domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00021125 | ETH_00021125-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 525 | ETH_00021125 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675067:246,535..248,178(-) | HG675067:246535..248178(-) | HG675067 | Eimeria tenella strain Houghton | 27 | OG6_106348 | 1 | 174 | 525 | 18691 | 4.23 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | | 2.7.1.71 (Shikimate kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00021125ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00021125 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00021130 | ETH_00021130-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 873 | ETH_00021130 | ATP-dependent heat shock protein, putative | ATP-dependent heat shock protein, putative | | | Not Assigned | HG675067:248,288..249,687(-) | HG675067:248288..249687(-) | HG675067 | Eimeria tenella strain Houghton | 27 | OG6_106348 | 1 | 290 | 873 | 32045 | 10.49 | 0 | HMM: MLARWAVPAQLRSIPRRVASVCAPSLNVLNSC, NN: MLARWAVPAQLRSIPRRVASV | NN Sum: 3, NN D: .45, HMM Prob: .42 | | | GO:0005524 | ATP binding | | | | | | | | | | 2.7.1.71 (Shikimate kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00021130ORATP-dependent heat shock protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00021130 OR ATP-dependent heat shock protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00021200 | ETH_00021200-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 1242 | ETH_00021200 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG676547:6,360..11,190(+) | HG676547:6360..11190(+) | HG676547 | Eimeria tenella strain Houghton | 815 | OG6_100282 | 76 | 413 | 1242 | 47295 | 6.37 | 0 | | | | | | | | | | | | | | | | 1.3.1.74 (2-alkenal reductase (NAD(P)(+))) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00021200ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00021200 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00021420 | ETH_00021420-t26_1 | 12 | 12 | 1 | | | reverse | protein coding | No | 2781 | ETH_00021420 | heat shock protein, putative | heat shock protein, putative | | | Not Assigned | HG674237:70,523..75,548(-) | HG674237:70523..75548(-) | HG674237 | Eimeria tenella strain Houghton | 119 | OG6_100223 | 4 | 926 | 2781 | 104112 | 6.61 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00021420ORheat shock protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00021420 OR heat shock protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00021485 | ETH_00021485-t26_1 | 10 | 10 | 1 | | | forward | protein coding | No | 2292 | ETH_00021485 | dipeptidyl peptidase IV domain-containing protein, putative | dipeptidyl peptidase IV domain-containing protein, putative | | | Not Assigned | HG674237:168,611..174,055(+) | HG674237:168611..174055(+) | HG674237 | Eimeria tenella strain Houghton | 2 | OG6_102236 | 0 | 763 | 2292 | 84355 | 8.15 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.5 (Dipeptidyl-peptidase IV) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00021485ORdipeptidyl peptidase IV domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00021485 OR dipeptidyl peptidase IV domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00021535 | ETH_00021535-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 627 | ETH_00021535 | proteasome subunit beta type 1, putative | proteasome subunit beta type 1, putative | | | Not Assigned | HG676507:3,661..7,587(+) | HG676507:3661..7587(+) | HG676507 | Eimeria tenella strain Houghton | 27 | OG6_101631 | 0 | 208 | 627 | 22756 | 9.97 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00021535ORproteasome subunit beta type 1, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00021535 OR proteasome subunit beta type 1, putative AND Eimeria tenella strain Houghton |
|
ETH_00021820 | ETH_00021820-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 780 | ETH_00021820 | proteasome subunit alpha type 3, putative | proteasome subunit alpha type 3, putative | | | Not Assigned | HG673761:70,837..73,684(-) | HG673761:70837..73684(-) | HG673761 | Eimeria tenella strain Houghton | 24 | OG6_102011 | 0 | 259 | 780 | 27478 | 7.79 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00021820ORproteasome subunit alpha type 3, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00021820 OR proteasome subunit alpha type 3, putative AND Eimeria tenella strain Houghton |
|
ETH_00022045 | ETH_00022045-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 6672 | ETH_00022045 | Possible conserved eukaryotic alpha beta hydrolase, related | Possible conserved eukaryotic alpha beta hydrolase, related | | | Not Assigned | HG675765:107,481..115,620(-) | HG675765:107481..115620(-) | HG675765 | Eimeria tenella strain Houghton | 56 | OG6_110414 | 2 | 2223 | 6672 | 231094 | 8.09 | 0 | HMM: MDSCHDFCCCGFSAAAAAA, NN: MDSCHDFCCCGFSAAAAAA | NN Sum: 1, NN D: .22, HMM Prob: .64 | | | | | | | | | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00022045ORPossible conserved eukaryotic alpha beta hydrolase, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00022045 OR Possible conserved eukaryotic alpha beta hydrolase, related AND Eimeria tenella strain Houghton |
|
ETH_00022120 | ETH_00022120-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 1364 | ETH_00022120 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG678157:241..4,389(+) | HG678157:241..4389(+) | HG678157 | Eimeria tenella strain Houghton | 72 | OG6_100121 | 1 | 454 | 1364 | 47376 | 4.27 | 1 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00022120ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00022120 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00022460 | ETH_00022460-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 1383 | ETH_00022460 | gamma-glutamyl hydrolase, putative | gamma-glutamyl hydrolase, putative | | | Not Assigned | HG675676:236,960..238,997(-) | HG675676:236960..238997(-) | HG675676 | Eimeria tenella strain Houghton | 27 | OG6_101559 | 0 | 460 | 1383 | 51322 | 5.72 | 0 | HMM: MSADAAAQPEKVAAAAAAVAAAVGPRTDSE, NN: MSADAAAQPEKVAAAAAAVAAAVGPRTDSE | NN Sum: 0, NN D: .09, HMM Prob: .72 | | | GO:0016787;GO:0008242 | hydrolase activity;omega peptidase activity | | | | | | | | | | 3.4.19.9 (Folate gamma-glutamyl hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00022460ORgamma-glutamyl hydrolase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00022460 OR gamma-glutamyl hydrolase, putative AND Eimeria tenella strain Houghton |
|
ETH_00022635 | ETH_00022635-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1110 | ETH_00022635 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675638:146,104..147,537(+) | HG675638:146104..147537(+) | HG675638 | Eimeria tenella strain Houghton | 6 | OG6r1_107508 | 0 | 369 | 1110 | 41946 | 11.10 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00022635ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00022635 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00022655 | ETH_00022655-t26_1 | 12 | 12 | 1 | | | forward | protein coding | No | 1338 | ETH_00022655 | Probable serine protease, related | Probable serine protease, related | | | Not Assigned | HG675638:202,575..205,689(+) | HG675638:202575..205689(+) | HG675638 | Eimeria tenella strain Houghton | 10 | OG6_100391 | 0 | 445 | 1338 | 48082 | 7.11 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.21.107 (Peptidase Do) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00022655ORProbable serine protease, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00022655 OR Probable serine protease, related AND Eimeria tenella strain Houghton |
|
ETH_00023050 | ETH_00023050-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1107 | ETH_00023050 | methionine aminopeptidase | methionine aminopeptidase | | | Not Assigned | HG675768:17,662..20,089(-) | HG675768:17662..20089(-) | HG675768 | Eimeria tenella strain Houghton | 33 | OG6_100815 | 0 | 368 | 1107 | 39621 | 8.28 | 0 | | | | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00023050ORmethionine aminopeptidaseANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00023050 OR methionine aminopeptidase AND Eimeria tenella strain Houghton |
|
ETH_00023380 | ETH_00023380-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1392 | ETH_00023380 | DNA-damage inducible protein, putative | DNA-damage inducible protein, putative | | | Not Assigned | HG678089:168,256..170,913(-) | HG678089:168256..170913(-) | HG678089 | Eimeria tenella strain Houghton | 33 | OG6_101685 | 0 | 463 | 1392 | 48955 | 5.11 | 0 | | | | | GO:0004190;GO:0005515 | aspartic-type endopeptidase activity;protein binding | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00023380ORDNA-damage inducible protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00023380 OR DNA-damage inducible protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00024050 | ETH_00024050-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 1752 | ETH_00024050 | acylglycerol lipase, putative | acylglycerol lipase, putative | | | Not Assigned | HG675525:156,033..158,559(+) | HG675525:156033..158559(+) | HG675525 | Eimeria tenella strain Houghton | 61 | OG6_100231 | 2 | 583 | 1752 | 61625 | 6.64 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00024050ORacylglycerol lipase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00024050 OR acylglycerol lipase, putative AND Eimeria tenella strain Houghton |
|
ETH_00024345 | ETH_00024345-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 549 | ETH_00024345 | Proteasome subunit beta type | Proteasome subunit beta type | | | Not Assigned | HG674763:106,599..107,810(-) | HG674763:106599..107810(-) | HG674763 | Eimeria tenella strain Houghton | 27 | OG6_101382 | 1 | 182 | 549 | 19632 | 5.57 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00024345ORProteasome subunit beta typeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00024345 OR Proteasome subunit beta type AND Eimeria tenella strain Houghton |
|
ETH_00024440 | ETH_00024440-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 948 | ETH_00024440 | 26S proteasome non-ATPase regulatory subunit 4, putative | 26S proteasome non-ATPase regulatory subunit 4, putative | | | Not Assigned | HG674763:205,491..207,809(+) | HG674763:205491..207809(+) | HG674763 | Eimeria tenella strain Houghton | 35 | OG6_102002 | 0 | 315 | 948 | 33197 | 4.32 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00024440OR26S proteasome non-ATPase regulatory subunit 4, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00024440 OR 26S proteasome non-ATPase regulatory subunit 4, putative AND Eimeria tenella strain Houghton |
|
ETH_00025015 | ETH_00025015-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 2463 | ETH_00025015 | cell division protein, putative | cell division protein, putative | | | Not Assigned | HG673830:16,429..21,694(+) | HG673830:16429..21694(+) | HG673830 | Eimeria tenella strain Houghton | 26 | OG6_134869 | 0 | 820 | 2463 | 85977 | 6.47 | 0 | | | | | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00025015ORcell division protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00025015 OR cell division protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00025020 | ETH_00025020-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 945 | ETH_00025020 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG673830:23,276..24,220(-) | HG673830:23276..24220(-) | HG673830 | Eimeria tenella strain Houghton | 28 | OG6_101420 | 1 | 314 | 945 | 32760 | 6.50 | 0 | HMM: MLPFDRLVLCGAPAASASAAAAAAAAAA, NN: MLPFDRLVLCGAPAASASAA | NN Sum: 2, NN D: .33, HMM Prob: 1 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00025020ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00025020 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00025030 | ETH_00025030-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 357 | ETH_00025030 | hypothetical protein | hypothetical protein | | | Not Assigned | HG673829:15,074..15,430(+) | HG673829:15074..15430(+) | HG673829 | Eimeria tenella strain Houghton | 0 | OG6r1_144467 | 1 | 118 | 357 | 12801 | 7.95 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00025030ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00025030 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00025040 | ETH_00025040-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 519 | ETH_00025040 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG673829:17,580..18,098(-) | HG673829:17580..18098(-) | HG673829 | Eimeria tenella strain Houghton | 589 | OG6_100000 | 20 | 172 | 519 | 18818 | 4.46 | 0 | | | | | | | | | | | | | | | | 2.3.2.27 (RING-type E3 ubiquitin transferase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00025040ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00025040 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00025050 | ETH_00025050-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 357 | ETH_00025050 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG673829:18,810..19,166(-) | HG673829:18810..19166(-) | HG673829 | Eimeria tenella strain Houghton | 0 | OG6r1_144467 | 1 | 118 | 357 | 12801 | 7.95 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00025050ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00025050 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00025145 | ETH_00025145-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 1320 | ETH_00025145 | Subtilisin-like | Subtilisin-like | | | Not Assigned | HG676224:389..2,961(+) | HG676224:389..2961(+) | HG676224 | Eimeria tenella strain Houghton | 33 | OG6_206249 | 1 | 439 | 1320 | 48309 | 4.73 | 0 | HMM: MRQIAAAATAAATLAAAADPAAAAAAA, NN: MRQIAAAATAAATLAAAADPAAAA | NN Sum: 1, NN D: .41, HMM Prob: 1 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00025145ORSubtilisin-likeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00025145 OR Subtilisin-like AND Eimeria tenella strain Houghton |
|
ETH_00025725 | ETH_00025725-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1140 | ETH_00025725 | eukaryotic aspartyl protease, putative | eukaryotic aspartyl protease, putative | | | Not Assigned | HG675767:109,828..111,038(-) | HG675767:109828..111038(-) | HG675767 | Eimeria tenella strain Houghton | 50 | OG6_100536 | 1 | 379 | 1140 | 42181 | 9.68 | 0 | | | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00025725OReukaryotic aspartyl protease, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00025725 OR eukaryotic aspartyl protease, putative AND Eimeria tenella strain Houghton |
|
ETH_00026235 | ETH_00026235-t26_1 | 4 | 4 | 1 | | 1 | reverse | protein coding | No | 1711 | ETH_00026235 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675343:2,868..5,719(-) | HG675343:2868..5718(-) | HG675343 | Eimeria tenella strain Houghton | 5 | OG6r1_109004 | 0 | 569 | 1710 | 60602 | 7.27 | 2 | HMM: LQWLAGAHRLRWLSAFELLLFGAFSSVLLAVGLELLAA, NN: LQWLAGAHRLRWLSAFELLLFGAFSSVLLAV | NN Sum: 4, NN D: .62, HMM Prob: .96 | | | GO:0008233 | peptidase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00026235ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00026235 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00026365 | ETH_00026365-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 156 | ETH_00026365 | radial spoke 3 protein, putative | radial spoke 3 protein, putative | | | Not Assigned | HG676393:212..568(+) | HG676393:212..568(+) | HG676393 | Eimeria tenella strain Houghton | 32 | OG6_107443 | 0 | 51 | 156 | 5567 | 7.35 | 0 | | | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00026365ORradial spoke 3 protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00026365 OR radial spoke 3 protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00026630 | ETH_00026630-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 2748 | ETH_00026630 | OTU-like cysteine protease domain-containing protein, putative | OTU-like cysteine protease domain-containing protein, putative | | | Not Assigned | HG673835:329,579..333,238(+) | HG673835:329579..333238(+) | HG673835 | Eimeria tenella strain Houghton | 6 | OG6_129646 | 0 | 915 | 2748 | 99724 | 6.35 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00026630OROTU-like cysteine protease domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00026630 OR OTU-like cysteine protease domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00026815 | ETH_00026815-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 435 | ETH_00026815 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG673774:50,046..50,540(-) | HG673774:50046..50540(-) | HG673774 | Eimeria tenella strain Houghton | 22 | OG6_162756 | 1 | 144 | 435 | 15770 | 4.96 | 0 | HMM: MPSMLHFLAHALFTICCLVQVGSGR, NN: MPSMLHFLAHALFTICCLVQVGSGR | NN Sum: 4, NN D: .77, HMM Prob: .99 | | | | | | | | | | | | | | 3.4.17.1 (Carboxypeptidase A) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00026815ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00026815 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00026860 | ETH_00026860-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 789 | ETH_00026860 | cysteine protease domain containing protein, putative | cysteine protease domain containing protein, putative | | | Not Assigned | HG673774:90,187..92,117(+) | HG673774:90187..92117(+) | HG673774 | Eimeria tenella strain Houghton | 24 | OG6_154459 | 0 | 262 | 789 | 29194 | 6.43 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00026860ORcysteine protease domain containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00026860 OR cysteine protease domain containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00026940 | ETH_00026940-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 960 | ETH_00026940 | hypothetical protein | hypothetical protein | | | Not Assigned | HG673774:175,773..176,732(+) | HG673774:175773..176732(+) | HG673774 | Eimeria tenella strain Houghton | 2 | OG6_118477 | 2 | 319 | 960 | 35907 | 7.33 | 0 | | | | | GO:0003676;GO:0008270 | nucleic acid binding;zinc ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00026940ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00026940 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00026985 | ETH_00026985-t26_1 | 11 | 11 | 1 | | | forward | protein coding | No | 1455 | ETH_00026985 | aspartyl aminopeptidase, putative | aspartyl aminopeptidase, putative | | | Not Assigned | HG673774:241,666..245,703(+) | HG673774:241666..245703(+) | HG673774 | Eimeria tenella strain Houghton | 34 | OG6_102047 | 0 | 484 | 1455 | 53678 | 6.79 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00026985ORaspartyl aminopeptidase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00026985 OR aspartyl aminopeptidase, putative AND Eimeria tenella strain Houghton |
|
ETH_00027335 | ETH_00027335-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 720 | ETH_00027335 | proteasome subunit alpha type 2, putative | proteasome subunit alpha type 2, putative | | | Not Assigned | HG675881:306..2,135(-) | HG675881:306..2135(-) | HG675881 | Eimeria tenella strain Houghton | 28 | OG6_101969 | 0 | 239 | 720 | 26101 | 4.97 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00027335ORproteasome subunit alpha type 2, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00027335 OR proteasome subunit alpha type 2, putative AND Eimeria tenella strain Houghton |
|
ETH_00027675 | ETH_00027675-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1093 | ETH_00027675 | Eukaryotic translation initiation factor 3 subunit 9, putative | Eukaryotic translation initiation factor 3 subunit 9, putative | | | Not Assigned | HG673752:1..2,641(-) | HG673752:1..2641(-) | HG673752 | Eimeria tenella strain Houghton | 34 | OG6_101924 | 1 | 364 | 1093 | 42036 | 4.78 | 0 | | | | | GO:0003676 | nucleic acid binding | | | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00027675OREukaryotic translation initiation factor 3 subunit 9, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00027675 OR Eukaryotic translation initiation factor 3 subunit 9, putative AND Eimeria tenella strain Houghton |
|
ETH_00028250 | ETH_00028250-t26_1 | 18 | 18 | 1 | | | forward | protein coding | No | 5928 | ETH_00028250 | Calcium binding egf domain containing protein, related | Calcium binding egf domain containing protein, related | | | Not Assigned | HG677946:216,498..227,371(+) | HG677946:216498..227371(+) | HG677946 | Eimeria tenella strain Houghton | 35 | OG6_155864 | 0 | 1975 | 5928 | 213858 | 5.96 | 0 | HMM: MQEETQRFGGHLFFSLGFWWLLASRVCST, NN: MQEETQRFGGHLFFSLGFWWLLASRVCST | NN Sum: 4, NN D: .6, HMM Prob: .93 | | | GO:0005509 | calcium ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00028250ORCalcium binding egf domain containing protein, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00028250 OR Calcium binding egf domain containing protein, related AND Eimeria tenella strain Houghton |
|
ETH_00028355 | ETH_00028355-t26_1 | 10 | 10 | 1 | | | forward | protein coding | No | 3180 | ETH_00028355 | trypsin, putative | trypsin, putative | | | Not Assigned | HG675673:70,278..74,946(+) | HG675673:70278..74946(+) | HG675673 | Eimeria tenella strain Houghton | 111 | OG6_105727 | 2 | 1059 | 3180 | 115787 | 6.76 | 0 | HMM: MRIILALSLSLTATFVDSY, NN: MRIILALSLSLTATFVDSY | NN Sum: 4, NN D: .77, HMM Prob: 1 | | | | | | | | | | | | | | 3.4.21.108 (HtrA2 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00028355ORtrypsin, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00028355 OR trypsin, putative AND Eimeria tenella strain Houghton |
|
ETH_00028585 | ETH_00028585-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 783 | ETH_00028585 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG676747:918..1,700(+) | HG676747:918..1700(+) | HG676747 | Eimeria tenella strain Houghton | 45 | OG6_101809 | 4 | 260 | 783 | 26832 | 7.73 | 0 | | | | | | | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00028585ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00028585 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00028620 | ETH_00028620-t26_1 | 11 | 11 | 1 | | | reverse | protein coding | No | 1692 | ETH_00028620 | PH domain-containing protein, putative | PH domain-containing protein, putative | | | Not Assigned | HG675119:4,781..11,200(-) | HG675119:4781..11200(-) | HG675119 | Eimeria tenella strain Houghton | 25 | OG6_129725 | 0 | 563 | 1692 | 62202 | 7.59 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00028620ORPH domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00028620 OR PH domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00028755 | ETH_00028755-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 291 | ETH_00028755 | hypothetical protein | hypothetical protein | | | Not Assigned | HG674134:63,727..64,017(-) | HG674134:63727..64017(-) | HG674134 | Eimeria tenella strain Houghton | 0 | OG6r1_278418 | 0 | 96 | 291 | 10170 | 4.80 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00028755ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00028755 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00028760 | ETH_00028760-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 306 | ETH_00028760 | hypothetical protein | hypothetical protein | | | Not Assigned | HG674134:64,733..65,038(-) | HG674134:64733..65038(-) | HG674134 | Eimeria tenella strain Houghton | 0 | OG6r1_278602 | 0 | 101 | 306 | 11004 | 10.81 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00028760ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00028760 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00028955 | ETH_00028955-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 738 | ETH_00028955 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG674134:274,193..276,144(+) | HG674134:274193..276144(+) | HG674134 | Eimeria tenella strain Houghton | 29 | OG6_108842 | 0 | 245 | 738 | 26398 | 6.42 | 0 | | | | | GO:0016787 | hydrolase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00028955ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00028955 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00028960 | ETH_00028960-t26_1 | 16 | 16 | 1 | | | reverse | protein coding | No | 2154 | ETH_00028960 | prolyl endopeptidase, putative | prolyl endopeptidase, putative | | | Not Assigned | HG674134:278,824..283,377(-) | HG674134:278824..283377(-) | HG674134 | Eimeria tenella strain Houghton | 29 | OG6_101804 | 0 | 717 | 2154 | 80341 | 5.42 | 0 | | | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.26 (Prolyl oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00028960ORprolyl endopeptidase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00028960 OR prolyl endopeptidase, putative AND Eimeria tenella strain Houghton |
|
ETH_00029300 | ETH_00029300-t26_1 | 15 | 15 | 1 | | | reverse | protein coding | No | 2304 | ETH_00029300 | X-prolyl aminopeptidase, putative | X-prolyl aminopeptidase, putative | | | Not Assigned | HG674134:624,079..629,712(-) | HG674134:624079..629712(-) | HG674134 | Eimeria tenella strain Houghton | 30 | OG6_100896 | 0 | 767 | 2304 | 84738 | 6.70 | 0 | | | | | GO:0016787 | hydrolase activity | | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00029300ORX-prolyl aminopeptidase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00029300 OR X-prolyl aminopeptidase, putative AND Eimeria tenella strain Houghton |
|
ETH_00029315 | ETH_00029315-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1107 | ETH_00029315 | OTU-like cysteine protease domain-containing protein, putative | OTU-like cysteine protease domain-containing protein, putative | | | Not Assigned | HG674134:647,165..648,271(-) | HG674134:647165..648271(-) | HG674134 | Eimeria tenella strain Houghton | 26 | OG6_110278 | 0 | 368 | 1107 | 41385 | 9.99 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00029315OROTU-like cysteine protease domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00029315 OR OTU-like cysteine protease domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00029965 | ETH_00029965-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 585 | ETH_00029965 | hypothetical protein | hypothetical protein | | | Not Assigned | HG673812:16,013..16,597(+) | HG673812:16013..16597(+) | HG673812 | Eimeria tenella strain Houghton | 7 | OG6_106819 | 2 | 194 | 585 | 21895 | 8.93 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00029965ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00029965 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00030160 | ETH_00030160-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 948 | ETH_00030160 | chromatin organization modifier domain-containing protein, putative | chromatin organization modifier domain-containing protein, putative | | | Not Assigned | HG673812:257,962..259,552(+) | HG673812:257962..259552(+) | HG673812 | Eimeria tenella strain Houghton | 26 | OG6_101530 | 0 | 315 | 948 | 33814 | 5.67 | 0 | | | | | | | | | | | | | | | | 3.4.19.3 (Pyroglutamyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00030160ORchromatin organization modifier domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00030160 OR chromatin organization modifier domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00030480 | ETH_00030480-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 810 | ETH_00030480 | hypothetical protein | hypothetical protein | | | Not Assigned | HG673787:79,310..82,122(-) | HG673787:79310..82122(-) | HG673787 | Eimeria tenella strain Houghton | 39 | OG6_100939 | 0 | 269 | 810 | 28022 | 8.65 | 0 | HMM: MILSSAALNLTGYQTAAAAHAA, NN: MILSSAALNLTGYQTAAAA | NN Sum: 0, NN D: .24, HMM Prob: .9 | | | | | | | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00030480ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00030480 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00030630 | ETH_00030630-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 1359 | ETH_00030630 | signal peptide peptidase domain-containing protein, putative | signal peptide peptidase domain-containing protein, putative | | | Not Assigned | HG675885:28,588..31,718(-) | HG675885:28588..31718(-) | HG675885 | Eimeria tenella strain Houghton | 34 | OG6_102328 | 0 | 452 | 1359 | 49729 | 6.91 | 8 | HMM: MSAGSTGDAAPTSAAPAAAGSTNSNTNCASGRNCRVSLSLFYSCLACLGLVLGS, NN: MSAGSTGDAAPTSAAPAAAGSTNSNTNCASGRNCRVSLSLFYSCLACLGLVLGS | NN Sum: 0, NN D: .24, HMM Prob: .7 | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00030630ORsignal peptide peptidase domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00030630 OR signal peptide peptidase domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00030655 | ETH_00030655-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 636 | ETH_00030655 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675885:56,816..57,574(+) | HG675885:56816..57574(+) | HG675885 | Eimeria tenella strain Houghton | 2 | OG6r1_124930 | 0 | 211 | 636 | 23242 | 8.26 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00030655ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00030655 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00030660 | ETH_00030660-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 636 | ETH_00030660 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675885:57,659..58,341(+) | HG675885:57659..58341(+) | HG675885 | Eimeria tenella strain Houghton | 0 | OG6r1_278564 | 0 | 211 | 636 | 22774 | 4.95 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00030660ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00030660 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00031210 | ETH_00031210-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 618 | ETH_00031210 | proteasome subunit beta type 3, putative | proteasome subunit beta type 3, putative | | | Not Assigned | HG675748:99,380..101,181(-) | HG675748:99380..101181(-) | HG675748 | Eimeria tenella strain Houghton | 21 | OG6_101970 | 0 | 205 | 618 | 22729 | 5.75 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00031210ORproteasome subunit beta type 3, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00031210 OR proteasome subunit beta type 3, putative AND Eimeria tenella strain Houghton |
|
ETH_00031265 | ETH_00031265-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 615 | ETH_00031265 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675748:165,419..166,033(+) | HG675748:165419..166033(+) | HG675748 | Eimeria tenella strain Houghton | 0 | OG6r1_277507 | 0 | 204 | 615 | 22971 | 8.45 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00031265ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00031265 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00031290 | ETH_00031290-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 684 | ETH_00031290 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675748:176,487..177,170(-) | HG675748:176487..177170(-) | HG675748 | Eimeria tenella strain Houghton | 4 | OG6_104492 | 0 | 227 | 684 | 25477 | 9.61 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00031290ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00031290 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00031480 | ETH_00031480-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 3102 | ETH_00031480 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675748:394,714..398,516(+) | HG675748:394714..398516(+) | HG675748 | Eimeria tenella strain Houghton | 0 | OG6_426500 | 0 | 1033 | 3102 | 112381 | 6.89 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00031480ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00031480 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00031605 | ETH_00031605-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1116 | ETH_00031605 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675748:525,864..526,979(+) | HG675748:525864..526979(+) | HG675748 | Eimeria tenella strain Houghton | 2 | OG6_118477 | 2 | 371 | 1116 | 41904 | 10.14 | 0 | | | | | GO:0003676;GO:0008270 | nucleic acid binding;zinc ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00031605ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00031605 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00031610 | ETH_00031610-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1185 | ETH_00031610 | Reverse transcriptase, related | Reverse transcriptase, related | | | Not Assigned | HG675748:527,002..528,275(+) | HG675748:527002..528275(+) | HG675748 | Eimeria tenella strain Houghton | 12 | OG6r1_102041 | 0 | 394 | 1185 | 42899 | 5.44 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00031610ORReverse transcriptase, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00031610 OR Reverse transcriptase, related AND Eimeria tenella strain Houghton |
|
ETH_00031705 | ETH_00031705-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 654 | ETH_00031705 | Os06g0273800 protein, related | Os06g0273800 protein, related | | | Not Assigned | HG675748:622,517..624,044(+) | HG675748:622517..624044(+) | HG675748 | Eimeria tenella strain Houghton | 32 | OG6_100807 | 1 | 217 | 654 | 23650 | 10.38 | 1 | | | GO:0016020 | membrane | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00031705OROs06g0273800 protein, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00031705 OR Os06g0273800 protein, related AND Eimeria tenella strain Houghton |
|
ETH_00031930 | ETH_00031930-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 4596 | ETH_00031930 | DNA repair protein, putative | DNA repair protein, putative | | | Not Assigned | HG675735:18,457..24,613(+) | HG675735:18457..24613(+) | HG675735 | Eimeria tenella strain Houghton | 27 | OG6_102113 | 0 | 1531 | 4596 | 161785 | 10.13 | 0 | | | | | GO:0003677 | DNA binding | | | | | | | | | | 2.1.1.201 (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00031930ORDNA repair protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00031930 OR DNA repair protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00032180 | ETH_00032180-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 1311 | ETH_00032180 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675733:108,311..111,414(-) | HG675733:108311..111414(-) | HG675733 | Eimeria tenella strain Houghton | 61 | OG6_100915 | 2 | 436 | 1311 | 48854 | 8.68 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00032180ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00032180 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00032220 | ETH_00032220-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 594 | ETH_00032220 | rhomboid-like protein | rhomboid-like protein | | | Not Assigned | HG675733:139,961..141,140(+) | HG675733:139961..141140(+) | HG675733 | Eimeria tenella strain Houghton | 52 | OG6_100562 | 1 | 197 | 594 | 22094 | 7.60 | 4 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00032220ORrhomboid-like proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00032220 OR rhomboid-like protein AND Eimeria tenella strain Houghton |
|
ETH_00032355 | ETH_00032355-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 927 | ETH_00032355 | GE18197, related | GE18197, related | | | Not Assigned | HG675728:182,621..186,585(+) | HG675728:182621..186585(+) | HG675728 | Eimeria tenella strain Houghton | 43 | OG6_101827 | 2 | 308 | 927 | 34481 | 9.50 | 0 | HMM: MKMKKENLYLLFLFLLFSHFPTPSNSI, NN: MKMKKENLYLLFLFLLFSHFPTPSNSI | NN Sum: 4, NN D: .81, HMM Prob: 1 | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00032355ORGE18197, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00032355 OR GE18197, related AND Eimeria tenella strain Houghton |
|
ETH_00032490 | ETH_00032490-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2421 | ETH_00032490 | ABC1 domain-containing protein, putative | ABC1 domain-containing protein, putative | | | Not Assigned | HG677985:4,079..6,499(-) | HG677985:4079..6499(-) | HG677985 | Eimeria tenella strain Houghton | 29 | OG6_100510 | 0 | 806 | 2421 | 87664 | 8.29 | 0 | | | | | | | | | | | | | | | | 2.7.-.- (Transferring phosphorus-containing groups.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00032490ORABC1 domain-containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00032490 OR ABC1 domain-containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00032550 | ETH_00032550-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 993 | ETH_00032550 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG677670:3,581..7,969(+) | HG677670:3581..7969(+) | HG677670 | Eimeria tenella strain Houghton | 56 | OG6_110414 | 2 | 330 | 993 | 34405 | 6.03 | 0 | | | | | | | | | | | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00032550ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00032550 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00032875 | ETH_00032875-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 804 | ETH_00032875 | 26S proteasome AAA-ATPase subunit RPT1, putative | 26S proteasome AAA-ATPase subunit RPT1, putative | | | Not Assigned | HG675848:306..3,090(+) | HG675848:306..3090(+) | HG675848 | Eimeria tenella strain Houghton | 29 | OG6_101899 | 1 | 267 | 804 | 29498 | 8.47 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00032875OR26S proteasome AAA-ATPase subunit RPT1, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00032875 OR 26S proteasome AAA-ATPase subunit RPT1, putative AND Eimeria tenella strain Houghton |
|
ETH_00032950 | ETH_00032950-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 1719 | ETH_00032950 | mitochondrial-processing peptidase alpha subunit, putative | mitochondrial-processing peptidase alpha subunit, putative | | | Not Assigned | HG673755:64,008..68,179(+) | HG673755:64008..68179(+) | HG673755 | Eimeria tenella strain Houghton | 27 | OG6_102381 | 0 | 572 | 1719 | 62774 | 8.32 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00032950ORmitochondrial-processing peptidase alpha subunit, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00032950 OR mitochondrial-processing peptidase alpha subunit, putative AND Eimeria tenella strain Houghton |
|
ETH_00033290 | ETH_00033290-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 435 | ETH_00033290 | 26S Proteasome non-ATPase regulatory subunit 9, putative | 26S Proteasome non-ATPase regulatory subunit 9, putative | | | Not Assigned | HG675723:36,795..37,497(+) | HG675723:36795..37497(+) | HG675723 | Eimeria tenella strain Houghton | 27 | OG6_102356 | 0 | 144 | 435 | 15363 | 4.97 | 0 | HMM: MAASAGASSLAAQAEAV, NN: MAASAGASSLAAQAEAV | NN Sum: 1, NN D: .11, HMM Prob: .83 | | | | | | | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00033290OR26S Proteasome non-ATPase regulatory subunit 9, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00033290 OR 26S Proteasome non-ATPase regulatory subunit 9, putative AND Eimeria tenella strain Houghton |
|
ETH_00033380 | ETH_00033380-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 984 | ETH_00033380 | machado-joseph disease protein, putative | machado-joseph disease protein, putative | | | Not Assigned | HG675723:136,901..140,308(+) | HG675723:136901..140308(+) | HG675723 | Eimeria tenella strain Houghton | 26 | OG6_104644 | 0 | 327 | 984 | 36287 | 5.24 | 0 | | | | | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00033380ORmachado-joseph disease protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00033380 OR machado-joseph disease protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00033530 | ETH_00033530-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 657 | ETH_00033530 | cathepsin L-like thiolproteinase, putative | cathepsin L-like thiolproteinase, putative | | | Not Assigned | HG675591:558..1,287(-) | HG675591:558..1287(-) | HG675591 | Eimeria tenella strain Houghton | 24 | OG6_100116 | 0 | 219 | 657 | 22321 | 5.27 | 0 | HMM: QPAPPSSASPAAAAAAAAAAG, NN: QPAPPSSASPAAAAAAAAAAG | NN Sum: 0, NN D: .17, HMM Prob: .98 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00033530ORcathepsin L-like thiolproteinase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00033530 OR cathepsin L-like thiolproteinase, putative AND Eimeria tenella strain Houghton |
|
ETH_00033545 | ETH_00033545-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 630 | ETH_00033545 | hypothetical protein | hypothetical protein | | | Not Assigned | HG674062:286..1,195(-) | HG674062:286..1195(-) | HG674062 | Eimeria tenella strain Houghton | 105 | OG6_106799 | 7 | 209 | 630 | 23050 | 7.16 | 0 | | | | | | | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00033545ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00033545 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00033650 | ETH_00033650-t26_1 | 8 | 8 | 1 | | 2 | forward | protein coding | No | 1574 | ETH_00033650 | lon protease, putative | lon protease, putative | | | Not Assigned | HG676862:18..3,173(+) | HG676862:20..3173(+) | HG676862 | Eimeria tenella strain Houghton | 36 | OG6_100411 | 3 | 523 | 1572 | 56339 | 5.17 | 0 | | | | | | | | | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00033650ORlon protease, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00033650 OR lon protease, putative AND Eimeria tenella strain Houghton |
|
ETH_00033725 | ETH_00033725-t26_1 | 4 | 4 | 1 | | 1 | forward | protein coding | No | 368 | ETH_00033725 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG676656:72..1,111(+) | HG676656:73..1111(+) | HG676656 | Eimeria tenella strain Houghton | 20 | OG6_224208 | 0 | 122 | 367 | 14001 | 6.24 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00033725ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00033725 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00033870 | ETH_00033870-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 486 | ETH_00033870 | hypothetical protein | hypothetical protein | | | Not Assigned | HG674801:521..1,435(-) | HG674801:521..1435(-) | HG674801 | Eimeria tenella strain Houghton | 119 | OG6_100223 | 4 | 161 | 486 | 17386 | 5.32 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00033870ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00033870 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00033920 | ETH_00033920-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 429 | ETH_00033920 | hypothetical protein | hypothetical protein | | | Not Assigned | HG674625:9..771(-) | HG674625:9..771(-) | HG674625 | Eimeria tenella strain Houghton | 45 | OG6_101809 | 4 | 143 | 429 | 15038 | 10.03 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00033920ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00033920 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00033960 | ETH_00033960-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 177 | ETH_00033960 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675319:110..469(-) | HG675319:110..469(-) | HG675319 | Eimeria tenella strain Houghton | 34 | OG6_102753 | 1 | 59 | 177 | 6707 | 7.61 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00033960ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00033960 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00034400 | ETH_00034400-t26_1 | 10 | 10 | 1 | | | reverse | protein coding | No | 4962 | ETH_00034400 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675627:54,059..61,517(-) | HG675627:54059..61517(-) | HG675627 | Eimeria tenella strain Houghton | 26 | OG6_101747 | 0 | 1653 | 4962 | 176933 | 7.74 | 9 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00034400ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00034400 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00034470 | ETH_00034470-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1530 | ETH_00034470 | 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial precursor, putative | 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial precursor, putative | | | Not Assigned | HG675627:134,682..137,948(-) | HG675627:134682..137948(-) | HG675627 | Eimeria tenella strain Houghton | 31 | OG6_102025 | 0 | 509 | 1530 | 55012 | 8.68 | 0 | HMM: MRTLCVPFGASVSRTSGS, NN: MRTLCVPFGASVSRTSGS | NN Sum: 0, NN D: .15, HMM Prob: .77 | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00034470OR3-hydroxyisobutyryl-CoA hydrolase, mitochondrial precursor, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00034470 OR 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial precursor, putative AND Eimeria tenella strain Houghton |
|
ETH_00034530 | ETH_00034530-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 1488 | ETH_00034530 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675627:180,596..182,638(-) | HG675627:180596..182638(-) | HG675627 | Eimeria tenella strain Houghton | 3 | OG6_107221 | 1 | 495 | 1488 | 54707 | 7.00 | 0 | | | | | GO:0003676;GO:0008270 | nucleic acid binding;zinc ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00034530ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00034530 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00034675 | ETH_00034675-t26_1 | 13 | 13 | 1 | | | reverse | protein coding | No | 3198 | ETH_00034675 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | Not Assigned | HG675627:326,042..332,552(-) | HG675627:326042..332552(-) | HG675627 | Eimeria tenella strain Houghton | 32 | OG6_101380 | 0 | 1065 | 3198 | 114457 | 4.63 | 0 | | | | | GO:0036459;GO:0008270 | thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00034675ORubiquitin carboxyl-terminal hydrolase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00034675 OR ubiquitin carboxyl-terminal hydrolase, putative AND Eimeria tenella strain Houghton |
|
ETH_00034790 | ETH_00034790-t26_1 | 14 | 14 | 1 | | | forward | protein coding | No | 1623 | ETH_00034790 | 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial, related | 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial, related | | | Not Assigned | HG675627:710,560..714,679(+) | HG675627:710560..714679(+) | HG675627 | Eimeria tenella strain Houghton | 42 | OG6_134153 | 0 | 540 | 1623 | 60421 | 6.07 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00034790OR3-hydroxyisobutyryl-CoA hydrolase, mitochondrial, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00034790 OR 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial, related AND Eimeria tenella strain Houghton |
|
ETH_00034825 | ETH_00034825-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1224 | ETH_00034825 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675617:5,057..8,209(-) | HG675617:5057..8209(-) | HG675617 | Eimeria tenella strain Houghton | 37 | OG6_102772 | 0 | 407 | 1224 | 43691 | 6.99 | 0 | | | | | | | | | | | | | | | | 3.1.13.4 (Poly(A)-specific ribonuclease) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00034825ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00034825 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00035140 | ETH_00035140-t26_1 | 10 | 10 | 1 | | 1 | reverse | protein coding | No | 1654 | ETH_00035140 | heat shock protein, putative | heat shock protein, putative | | | Not Assigned | HG675164:315,325..321,494(-) | HG675164:315325..321493(-) | HG675164 | Eimeria tenella strain Houghton | 119 | OG6_100223 | 4 | 550 | 1653 | 61187 | 7.92 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00035140ORheat shock protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00035140 OR heat shock protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00035225 | ETH_00035225-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 333 | ETH_00035225 | heat shock protein hslv, putative | heat shock protein hslv, putative | | | Not Assigned | HG673943:6,952..8,936(-) | HG673943:6952..8936(-) | HG673943 | Eimeria tenella strain Houghton | 29 | OG6_107204 | 0 | 110 | 333 | 11711 | 4.46 | 0 | | | | | | | | | | | | | | | | 3.4.25.2 (HslU--HslV peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00035225ORheat shock protein hslv, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00035225 OR heat shock protein hslv, putative AND Eimeria tenella strain Houghton |
|
ETH_00035240 | ETH_00035240-t26_1 | 2 | 2 | 1 | | 1 | reverse | protein coding | No | 367 | ETH_00035240 | proteasome subunit beta type 2, putative | proteasome subunit beta type 2, putative | | | Not Assigned | HG673943:20,613..22,283(-) | HG673943:20613..22282(-) | HG673943 | Eimeria tenella strain Houghton | 22 | OG6_102061 | 1 | 121 | 366 | 13679 | 8.19 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00035240ORproteasome subunit beta type 2, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00035240 OR proteasome subunit beta type 2, putative AND Eimeria tenella strain Houghton |
|
ETH_00035345 | ETH_00035345-t26_1 | 2 | 2 | 1 | | 2 | reverse | protein coding | No | 1931 | ETH_00035345 | M16 family peptidase, putative | M16 family peptidase, putative | | | Not Assigned | HG676077:148..2,153(-) | HG676077:148..2151(-) | HG676077 | Eimeria tenella strain Houghton | 30 | OG6_105738 | 0 | 642 | 1929 | 66065 | 5.28 | 0 | | | | | | | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00035345ORM16 family peptidase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00035345 OR M16 family peptidase, putative AND Eimeria tenella strain Houghton |
|
ETH_00035355 | ETH_00035355-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 369 | ETH_00035355 | CBN-RPT-3 protein, related | CBN-RPT-3 protein, related | | | Not Assigned | HG676058:1,670..2,504(-) | HG676058:1670..2504(-) | HG676058 | Eimeria tenella strain Houghton | 30 | OG6_101965 | 0 | 122 | 369 | 13992 | 10.21 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00035355ORCBN-RPT-3 protein, relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00035355 OR CBN-RPT-3 protein, related AND Eimeria tenella strain Houghton |
|
ETH_00035535 | ETH_00035535-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 2826 | ETH_00035535 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG673979:2,370..6,249(+) | HG673979:2370..6249(+) | HG673979 | Eimeria tenella strain Houghton | 1 | OG6_124447 | 0 | 942 | 2826 | 97387 | 10.21 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00035535ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00035535 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00035660 | ETH_00035660-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 206 | ETH_00035660 | hypothetical protein | hypothetical protein | | | Not Assigned | HG677779:1..1,172(-) | HG677779:1..1172(-) | HG677779 | Eimeria tenella strain Houghton | 29 | OG6_101899 | 1 | 68 | 206 | 7624 | 4.52 | 0 | | | | | | | | | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00035660ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00035660 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00035800 | ETH_00035800-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 262 | ETH_00035800 | hypothetical protein | hypothetical protein | | | Not Assigned | HG677722:122..793(+) | HG677722:122..793(+) | HG677722 | Eimeria tenella strain Houghton | 42 | OG6_102110 | 2 | 87 | 262 | 9491 | 5.53 | 0 | | | | | | | | | | | | | | | | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00035800ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00035800 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00035890 | ETH_00035890-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 757 | ETH_00035890 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675434:477..1,233(+) | HG675434:477..1233(+) | HG675434 | Eimeria tenella strain Houghton | 19 | OG6_490204 | 0 | 252 | 757 | 26092 | 8.33 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00035890ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00035890 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00036665 | ETH_00036665-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 282 | ETH_00036665 | signal peptidase, putative | signal peptidase, putative | | | Not Assigned | HG674170:352..928(-) | HG674170:352..928(-) | HG674170 | Eimeria tenella strain Houghton | 32 | OG6_100807 | 1 | 93 | 282 | 10352 | 6.51 | 0 | | | | | | | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00036665ORsignal peptidase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00036665 OR signal peptidase, putative AND Eimeria tenella strain Houghton |
|
ETH_00037120 | ETH_00037120-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 408 | ETH_00037120 | Atp-dependent metalloprotease ftsh, putative (Fragment) | Atp-dependent metalloprotease ftsh, putative (Fragment) | | | Not Assigned | HG675189:772..2,420(+) | HG675189:772..2420(+) | HG675189 | Eimeria tenella strain Houghton | 44 | OG6_101196 | 0 | 135 | 408 | 14325 | 5.15 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00037120ORAtp-dependent metalloprotease ftsh, putative (Fragment)ANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00037120 OR Atp-dependent metalloprotease ftsh, putative (Fragment) AND Eimeria tenella strain Houghton |
|
ETH_00037385 | ETH_00037385-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 1491 | ETH_00037385 | hypothetical protein | hypothetical protein | | | Not Assigned | HG675329:330..2,469(+) | HG675329:330..2469(+) | HG675329 | Eimeria tenella strain Houghton | 36 | OG6_174421 | 2 | 496 | 1491 | 52938 | 8.95 | 0 | | | | | | | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00037385ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00037385 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00037410 | ETH_00037410-t26_1 | 7 | 7 | 1 | | 1 | forward | protein coding | No | 1033 | ETH_00037410 | Lon protease homolog, mitochondrial , related | Lon protease homolog, mitochondrial , related | | | Not Assigned | HG677330:65..2,310(+) | HG677330:66..2310(+) | HG677330 | Eimeria tenella strain Houghton | 36 | OG6_100411 | 3 | 343 | 1032 | 35397 | 4.53 | 0 | | | | | GO:0004176;GO:0004252 | ATP-dependent peptidase activity;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00037410ORLon protease homolog, mitochondrial , relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00037410 OR Lon protease homolog, mitochondrial , related AND Eimeria tenella strain Houghton |
|
ETH_00037950 | ETH_00037950-t26_1 | 4 | 4 | 1 | | 1 | reverse | protein coding | No | 958 | ETH_00037950 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG674788:3,741..5,363(-) | HG674788:3741..5362(-) | HG674788 | Eimeria tenella strain Houghton | 33 | OG6_102579 | 0 | 318 | 957 | 33531 | 4.89 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00037950ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00037950 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00038595 | ETH_00038595-t26_1 | 9 | 9 | 1 | | | reverse | protein coding | No | 2096 | ETH_00038595 | hypothetical protein | hypothetical protein | | | Not Assigned | HG674905:6..6,192(-) | HG674905:6..6192(-) | HG674905 | Eimeria tenella strain Houghton | 0 | OG6r1_277897 | 0 | 699 | 2096 | 72535 | 6.55 | 2 | HMM: MDRAAAGTPLDPHESSGDCCTAAALLLPAAAAAAAAA, NN: MDRAAAGTPLDPHESSGDCCTAAALLLPAAAAAAAAA | NN Sum: 1, NN D: .3, HMM Prob: .92 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00038595ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00038595 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00038820 | ETH_00038820-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 606 | ETH_00038820 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG677498:319..1,437(-) | HG677498:319..1437(-) | HG677498 | Eimeria tenella strain Houghton | 105 | OG6_106799 | 7 | 201 | 606 | 21739 | 5.32 | 0 | | | | | | | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00038820ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00038820 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00039140 | ETH_00039140-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 369 | ETH_00039140 | hypothetical protein | hypothetical protein | | | Not Assigned | HG676745:48..852(+) | HG676745:48..852(+) | HG676745 | Eimeria tenella strain Houghton | 36 | OG6_113142 | 1 | 122 | 369 | 14194 | 5.99 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00039140ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00039140 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00039250 | ETH_00039250-t26_1 | 4 | 4 | 1 | | 2 | reverse | protein coding | No | 1280 | ETH_00039250 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG674958:241..1,973(-) | HG674958:241..1971(-) | HG674958 | Eimeria tenella strain Houghton | 1 | OG6r1_143519 | 0 | 426 | 1278 | 45405 | 9.78 | 0 | | | | | | | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00039250ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00039250 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00039610 | ETH_00039610-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 516 | ETH_00039610 | peptidase family M3 domain containing protein, putative | peptidase family M3 domain containing protein, putative | | | Not Assigned | HG676623:224..1,373(+) | HG676623:224..1373(+) | HG676623 | Eimeria tenella strain Houghton | 42 | OG6_102110 | 2 | 172 | 516 | 18835 | 5.03 | 0 | | | | | | | | | | | | | | | | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00039610ORpeptidase family M3 domain containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00039610 OR peptidase family M3 domain containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00040020 | ETH_00040020-t26_1 | 2 | 2 | 1 | | 1 | forward | protein coding | No | 202 | ETH_00040020 | hypothetical protein | hypothetical protein | | | Not Assigned | HG674842:960..1,364(+) | HG674842:961..1364(+) | HG674842 | Eimeria tenella strain Houghton | 33 | OG6_113993 | 1 | 66 | 201 | 7255 | 4.53 | 0 | | | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.17.12 (Carboxypeptidase M) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00040020ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00040020 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00040290 | ETH_00040290-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 948 | ETH_00040290 | hypothetical protein | hypothetical protein | | | Not Assigned | HG674084:4,466..5,855(+) | HG674084:4466..5855(+) | HG674084 | Eimeria tenella strain Houghton | 0 | OG6r1_278637 | 0 | 315 | 948 | 32435 | 7.70 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00040290ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00040290 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00040295 | ETH_00040295-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 444 | ETH_00040295 | hypothetical protein | hypothetical protein | | | Not Assigned | HG674094:548..1,741(-) | HG674094:548..1741(-) | HG674094 | Eimeria tenella strain Houghton | 45 | OG6_101809 | 4 | 147 | 444 | 15849 | 5.80 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00040295ORhypothetical proteinANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00040295 OR hypothetical protein AND Eimeria tenella strain Houghton |
|
ETH_00040480 | ETH_00040480-t26_1 | 10 | 10 | 1 | | | forward | protein coding | No | 1344 | ETH_00040480 | Rhomboid family protein , related | Rhomboid family protein , related | | | Not Assigned | HG677594:53..3,466(+) | HG677594:53..3466(+) | HG677594 | Eimeria tenella strain Houghton | 33 | OG6_127785 | 0 | 448 | 1344 | 48555 | 9.30 | 5 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00040480ORRhomboid family protein , relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00040480 OR Rhomboid family protein , related AND Eimeria tenella strain Houghton |
|
ETH_00040620 | ETH_00040620-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1611 | ETH_00040620 | metacaspase 1 precursor, putative | metacaspase 1 precursor, putative | | | Not Assigned | HG675554:48..2,201(-) | HG675554:48..2201(-) | HG675554 | Eimeria tenella strain Houghton | 36 | OG6_101407 | 0 | 537 | 1611 | 61032 | 9.84 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00040620ORmetacaspase 1 precursor, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00040620 OR metacaspase 1 precursor, putative AND Eimeria tenella strain Houghton |
|
ETH_00040630 | ETH_00040630-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 738 | ETH_00040630 | peptidase M16 domain containing protein, putative | peptidase M16 domain containing protein, putative | | | Not Assigned | HG677046:4..1,214(-) | HG677046:4..1214(-) | HG677046 | Eimeria tenella strain Houghton | 36 | OG6_174421 | 2 | 246 | 738 | 24735 | 6.24 | 0 | | | | | | | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00040630ORpeptidase M16 domain containing protein, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00040630 OR peptidase M16 domain containing protein, putative AND Eimeria tenella strain Houghton |
|
ETH_00040925 | ETH_00040925-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 738 | ETH_00040925 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG676565:148..1,090(+) | HG676565:148..1090(+) | HG676565 | Eimeria tenella strain Houghton | 24 | OG6_102202 | 0 | 246 | 738 | 27715 | 4.17 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00040925ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00040925 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00042070 | ETH_00042070-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1110 | ETH_00042070 | M16 family peptidase, putative | M16 family peptidase, putative | | | Not Assigned | HG677390:37..1,365(-) | HG677390:37..1365(-) | HG677390 | Eimeria tenella strain Houghton | 85 | OG6_100422 | 3 | 369 | 1110 | 39227 | 8.45 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00042070ORM16 family peptidase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00042070 OR M16 family peptidase, putative AND Eimeria tenella strain Houghton |
|
ETH_00042435 | ETH_00042435-t26_1 | 4 | 4 | 1 | | 1 | forward | protein coding | No | 1071 | ETH_00042435 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675420:464..2,034(+) | HG675420:465..2034(+) | HG675420 | Eimeria tenella strain Houghton | 31 | OG6_102318 | 0 | 356 | 1070 | 36972 | 9.28 | 0 | HMM: AAAAAAATATAAAAAAAAAE, NN: AAAAAAATATAAAAAAAAAE | NN Sum: 0, NN D: .28, HMM Prob: 1 | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00042435ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00042435 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00042575 | ETH_00042575-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 444 | ETH_00042575 | Lon protease homolog, mitochondrial , related | Lon protease homolog, mitochondrial , related | | | Not Assigned | HG675106:524..1,561(-) | HG675106:524..1561(-) | HG675106 | Eimeria tenella strain Houghton | 36 | OG6_100411 | 3 | 147 | 444 | 16341 | 5.80 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00042575ORLon protease homolog, mitochondrial , relatedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00042575 OR Lon protease homolog, mitochondrial , related AND Eimeria tenella strain Houghton |
|
ETH_00042640 | ETH_00042640-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 399 | ETH_00042640 | proteasome subunit beta type 7, putative | proteasome subunit beta type 7, putative | | | Not Assigned | HG677761:3,688..4,086(+) | HG677761:3688..4086(+) | HG677761 | Eimeria tenella strain Houghton | 27 | OG6_101382 | 1 | 133 | 399 | 13924 | 8.35 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00042640ORproteasome subunit beta type 7, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00042640 OR proteasome subunit beta type 7, putative AND Eimeria tenella strain Houghton |
|
ETH_00042675 | ETH_00042675-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 435 | ETH_00042675 | subtilase family serine protease, putative | subtilase family serine protease, putative | | | Not Assigned | HG677020:1,033..1,467(-) | HG677020:1033..1467(-) | HG677020 | Eimeria tenella strain Houghton | 20 | OG6_116777 | 1 | 144 | 435 | 15690 | 12.23 | 0 | HMM: MAAPMVSGVAAEVLGVSPWSLPQ, NN: MAAPMVSGVAAE | NN Sum: 0, NN D: .24, HMM Prob: .59 | | | | | | | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00042675ORsubtilase family serine protease, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00042675 OR subtilase family serine protease, putative AND Eimeria tenella strain Houghton |
|
ETH_00042760 | ETH_00042760-t26_1 | 3 | 3 | 1 | | 2 | reverse | protein coding | No | 437 | ETH_00042760 | zinc carboxypeptidase, putative | zinc carboxypeptidase, putative | | | Not Assigned | HG677373:418..1,342(-) | HG677373:418..1340(-) | HG677373 | Eimeria tenella strain Houghton | 33 | OG6_113993 | 1 | 144 | 435 | 16466 | 5.29 | 0 | HMM: SWGFAFVGRAVYELTEAF, NN: SWGFAFVGRAVYELTEAF | NN Sum: 4, NN D: .45, HMM Prob: .11 | | | | | | | | | | | | | | 3.4.17.12 (Carboxypeptidase M) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00042760ORzinc carboxypeptidase, putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00042760 OR zinc carboxypeptidase, putative AND Eimeria tenella strain Houghton |
|
ETH_00042825 | ETH_00042825-t26_1 | 1 | 1 | 1 | | 2 | reverse | protein coding | No | 236 | ETH_00042825 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG674863:350..585(-) | HG674863:350..583(-) | HG674863 | Eimeria tenella strain Houghton | 105 | OG6_106799 | 7 | 77 | 234 | 8945 | 11.16 | 0 | | | | | | | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00042825ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00042825 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00043200 | ETH_00043200-t26_1 | 2 | 2 | 1 | | 1 | reverse | protein coding | No | 457 | ETH_00043200 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG673942:1,074..1,632(-) | HG673942:1074..1631(-) | HG673942 | Eimeria tenella strain Houghton | 29 | OG6_113449 | 1 | 151 | 456 | 17664 | 10.26 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00043200ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00043200 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_00043935 | ETH_00043935-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 612 | ETH_00043935 | hypothetical protein, conserved | hypothetical protein, conserved | | | Not Assigned | HG675020:385..2,082(-) | HG675020:385..2082(-) | HG675020 | Eimeria tenella strain Houghton | 105 | OG6_106799 | 7 | 203 | 612 | 23307 | 8.91 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_00043935ORhypothetical protein, conservedANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_00043935 OR hypothetical protein, conserved AND Eimeria tenella strain Houghton |
|
ETH_0005000 | ETH_0005000-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 578 | ETH_0005000 | cathepsin C2 (TgCPC2), putative | cathepsin C2 (TgCPC2), putative | | | Not Assigned | HG673982:358..2,409(-) | HG673982:358..2409(-) | HG673982 | Eimeria tenella strain Houghton | 23 | OG6_148524 | 0 | 193 | 578 | 21098 | 9.66 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=ETH_0005000ORcathepsin C2 (TgCPC2), putativeANDEimeria tenella strain Houghton | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=ETH_0005000 OR cathepsin C2 (TgCPC2), putative AND Eimeria tenella strain Houghton |